In [20]:
import pandas as pd
import numpy as np
import matplotlib.pyplot as plt
import networkx as nx
import brewer2mpl
import math


from datetime import datetime
from Bio import AlignIO, SeqIO
from Bio.SeqRecord import SeqRecord
from Bio.Align.Applications import ClustalOmegaCommandline
from __future__ import division
from Bio.Seq import Seq
from collections import Counter
from sdi import sdi
from copy import deepcopy
from random import shuffle
from scipy.stats.mstats import mquantiles
from sklearn.ensemble import RandomForestClassifier
from sklearn.preprocessing import LabelEncoder

%matplotlib inline

Background

Truc has the dataset in one massive spreadsheet right now. I am going to filter out:

  1. Stuff that doesn't have a full sequence.
  2. Stuff that has host type coded as "Avian (unidentified)".

Also, I will have to check that the accessions are "complete CDS" and not "partial CDS" - this is proxied by filtering on the "trimmed sequences" column such that anything that doesn't start with an "ATG" and have a CDS that is > 500 a.a. is filtered out.


In [2]:
data = pd.read_csv('H9_HA_dataset.csv', index_col='Accession ')
data = data[data['Trimmed Sequence*'].str[0:3] == 'ATG']
data['Trimmed Sequence*'] = data['Trimmed Sequence*'].str.replace('~', '')
data['Trimmed Sequence*'] = data['Trimmed Sequence*'].str.replace('-', '')
data['Sequence Length'] = data['Trimmed Sequence*'].str.len()
data = data[data['HostType_Code1'] != 'Avian (unidentified)'] # filter out unidentified
data['Geo_Code'] = data['Geo_Code'].str.replace('_', '.')
plt.hist(data['Sequence Length'].values, bins=100)
plt.show()
data = data[data['Sequence Length'] > 1600] # filter out non-full length
data


Out[2]:
Host Species HostCategory_Islam HostTaxa_Nic HostType_Nic HostType_Code1 HostType_Code1S HostType_Code2 HostOrder_Nic Geo_Code ... Date_Est Gene segment Taxa label Trimmed Sequence* Unnamed: 22 Unnamed: 23 Unnamed: 24 Unnamed: 25 Unnamed: 26 Sequence Length
Accession
CY031275 Avian duck-quail adapted ? Poultry Domestic animal Domestic D Quail Galliformes China.Central ... 1979-06-15 >4 A/duck/Hong Kong/702/1979-quail adapted ATGGAAACAAAAGCACTAATAGCTATACTGTTAATGGTAACAACAA... NaN NaN NaN NaN NaN 1709
KF188339 Avian goose Anseriformes Anseriformes Wild bird Wild W Anseriformes Anseriformes N.Amer ... 1980-06-15 >4 A/goose/Minnesota/5733-1243/1980 ATGGAAACAACAACACTAATAGCTATACTGCTAATGGTAACAGCAA... NaN NaN NaN NaN NaN 1683
KF188287 Avian turkey Poultry Poultry Domestic animal Domestic D Turkey Galliformes Europe ... 1983-06-15 >4 A/turkey/Pavia/141/1983 ATGGAGACAATAGCACCAATAGCTATACTGTTAATGGTAACAGCAG... NaN NaN NaN NaN NaN 1683
CY005919 Avian mallard Anseriformes Anseriformes Wild bird Wild W Anseriformes Anseriformes N.Amer ... 1983-08-07 >4 A/mallard duck/ALB/396/1983 ATGGAAATAACAACACTAATAGCTATACTGCTAATGGTAACAGCAA... NaN NaN NaN NaN NaN 1709
CY101406 Avian ruddy turnstone Charadriiformes Charadriiformes Wild bird Wild W Charadriiformes Charadriiformes N.Amer ... 1987-05-19 >4 A/ruddy turnstone/Delaware Bay/2795/1987 ATGGAAATAACAACACTAGTAGCTATACTGCTAATGGTAACAGCAA... NaN NaN NaN NaN NaN 1696
CY005986 Avian laughing gull Charadriiformes Charadriiformes Wild bird Wild W Charadriiformes Charadriiformes N.Amer ... 1987-06-09 >4 A/laughing gull/Delaware Bay/2718/1987 ATGGAAATAACAACACTAGTAGCTATACTGCTAATGGTAACAGCAA... NaN NaN NaN NaN NaN 1709
CY101507 Avian ruddy turnstone Charadriiformes Charadriiformes Wild bird Wild W Charadriiformes Charadriiformes N.Amer ... 1988-05-28 >4 A/ruddy turnstone/Virginia/2297/1988 ATGGAAATAACAACACTAGTAGCTATACTGATAATGGTAACAGCAA... NaN NaN NaN NaN NaN 1696
AB303077 Avian mallard Anseriformes Anseriformes Wild bird Wild W Anseriformes Anseriformes Europe ... 1993-06-15 >4 A/mallard/Ireland/PV46B/1993 ATGGAAATAACAGCATTAATAGCTATACTGTTAGTGACAACAACAA... NaN NaN NaN NaN NaN 1690
AF156379 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 1994-06-15 >4 A/Chicken/Hong Kong/739/94 ATGGAAACAATATCACTAATAACTATACTACTAGTAATAACAGCAA... NaN NaN NaN NaN NaN 1671
HE802066 Avian duck ? Duck (unidentified) Wild bird Wild W Anseriformes Anseriformes Europe ... 1995-06-15 >4 A/duck/Germany/113/1995 ATGGAAATAATAGCACTAATAGCTATACTGTTAGTGACAACAACAA... NaN NaN NaN NaN NaN 1709
JX273569 Avian turkey Poultry Poultry Domestic animal Domestic D Turkey Galliformes Europe ... 1995-06-15 >4 A/turkey/Germany/EK224/1995 ATGGAAATAATAGCATTAATAGCTATACTGTTAGTGACAACAACAA... NaN NaN NaN NaN NaN 1709
CY102188 Avian shorebird Charadriiformes Charadriiformes Wild bird Wild W Charadriiformes Charadriiformes N.Amer ... 1996-05-14 >4 A/shorebird/Delaware Bay/31/1996 ATGGAAACCAGAACACTAATAGCTGCGCTTCTGATTGTAACAACAA... NaN NaN NaN NaN NaN 1683
DQ064377 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 1996-06-15 >4 A/chicken/Shandong/7/96 ATGGAAACAACATCACTAATAACTATACTACTACTAGTAACAACAA... NaN NaN NaN NaN NaN 1709
GU053186 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 1996-06-15 >4 A/chicken/Korea/MS96-CE6/1996 ATGGAAATAATAGCACTAATAGCTATACTGGTAGTGACAAAAACAA... NaN NaN NaN NaN NaN 1696
AB049159 Avian parakeet Passeriformes? Psittaciformes Captive wild Wild W Other NaN E.Asia.E.China ... 1997-06-15 >4 A/parakeet/Chiba/1/97 ATGGAAACAATATCACTACTAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1683
AB432938 Avian duck Poultry Poultry Domestic animal Domestic D DomDuckGeese Anseriformes China.Central ... 1997-06-15 >4 A/duck/Hong Kong/W213/1997 ATGGAAGCAGTATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1683
DQ064360 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 1997-06-15 >4 A/chicken/Guangdong/5/97 ATGGAAGCAGTATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1709
JQ344328 Avian duck ? Poultry Domestic animal Domestic D DomDuckGeese Anseriformes SE.Asia ... 1997-09-24 >4 A/duck/Malaysia/91/1997 ATGGAAGCAACAGCAATAATAACCATACTATTAGTAATAACAGCAA... NaN NaN NaN NaN NaN 1709
KF800947 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 1998-02-02 >4 A/chicken/Iran/av1221/1998 ATGGAACAGGTATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1683
AB049160 Avian parakeet Passeriformes? Psittaciformes Captive wild Wild W Other NaN E.Asia.E.China ... 1998-06-15 >4 A/parakeet/Narita/92A/98 ATGGAAACAATATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1683
AF461510 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 1998-06-15 >4 A/Chicken/Jiangsu/2/98 ATGGAAACAATATCACTAATAACTATACTACTAGTAGTAACAGTAA... NaN NaN NaN NaN NaN 1683
AY743216 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 1998-06-15 >4 A/Chicken/Shanghai/F/98 ATGGAAACAATATCACTAATAGCTATACTACTAGTAGTAACAGTAA... NaN NaN NaN NaN NaN 1709
CY081264 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 1998-06-15 >4 A/chicken/Saudi Arabia/CP7/1998 ATGGAAACAATATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1680
FJ794817 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 1998-06-15 >4 A/chicken/Iran/SS1/1998 ATGGAAACAGTATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1709
JQ419725 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 1998-06-15 >4 A/chicken/Iran/725/1998 ATGGAAACAACATCACTGTTAACTATACTACTAGTAGTAACAACAA... NaN NaN NaN NaN NaN 1677
GQ497118 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 1998-10-26 >4 A/chicken/Iran/661/1998 ATGGAACAGGTATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1677
AF461512 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.West ... 1999-06-15 >4 A/Chicken/Gansu/1/99 ATGGAAACAATATCACTAATAACTATACTACTAATAGTAACAGCAG... NaN NaN NaN NaN NaN 1683
AF461528 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.West ... 1999-06-15 >4 A/Chicken/Yunnan/1/99 ATGGAAACAATATCACTAATAACTATAATACTAGTAGTAACGGTAA... NaN NaN NaN NaN NaN 1683
AF508556 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes S.Asia ... 1999-06-15 >4 A/chicken/Pakistan/5/99 ATGGAAACAAGATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1648
AF508568 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.West ... 1999-06-15 >4 A/Chicken/Ningxia/5/99 ATGGAAACAATATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1634
... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ...
JN804540 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 2011-07-15 >4 A/chicken/Shanxi/43/2011 ATGGAGACAGTATCACTAATAACTATACTACTAGTAGTAACAGTAA... NaN NaN NaN NaN NaN 1675
JN804542 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.West ... 2011-07-15 >4 A/chicken/Chongqing/K7/2011 ATGGAGACAGCATCACTAATAACTATGCTACTAGTAGCAACAGTAA... NaN NaN NaN NaN NaN 1675
JN804543 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.West ... 2011-07-15 >4 A/chicken/Chongqing/K16/2011 ATGGAGACAGTATCTCTAATAACTATACTACTAGTATTAACAGTAA... NaN NaN NaN NaN NaN 1675
JN804544 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.West ... 2011-07-15 >4 A/chicken/Chongqing/K3/2011 ATGGAGACAGTATCTCTAATAACTATACTACTAGTATTAACAGTAA... NaN NaN NaN NaN NaN 1675
JN804545 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.West ... 2011-07-15 >4 A/chicken/Chongqing/A56/2011 ATGGAGACAGTATCTCTAATAACTATACTACTAGTATTAACAGTAA... NaN NaN NaN NaN NaN 1675
JN804547 Avian duck Poultry Poultry Domestic animal Domestic D DomDuckGeese Anseriformes China.West ... 2011-07-15 >4 A/duck/Chongqing/B36/2011 ATGGAGACAGTATCTCTAATAACTATACTACTAGTATTAACAGTAA... NaN NaN NaN NaN NaN 1675
JN804557 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 2011-07-15 >4 A/chicken/Guangdong/286/2011 ATGGAAGCAGCAACAATAATAACTATACTACTAGCAATAACAGGAA... NaN NaN NaN NaN NaN 1675
JQ906555 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2011-10-15 >4 A/chicken/Egypt/115636V/2011 ATGGAAATAACACCACTGATGACTATACTACTATTAGTAACAACAA... NaN NaN NaN NaN NaN 1683
KC162234 Avian baikal teal Anseriformes Anseriformes Wild bird Wild W Anseriformes Anseriformes E.Asia.E.China ... 2011-10-15 >4 A/baikal teal/Xianghai/421/2011 ATGGAAATAATAGCACTAATAGCTATACTATTAGTAACAACAACGA... NaN NaN NaN NaN NaN 1683
CY110927 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2011-12-15 >4 A/chicken/Egypt/S4454E/2011 ATGGAAATAATACCACTGACGACTATACTACTATTAGTAACAACAA... NaN NaN NaN NaN NaN 1685
CY110928 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2011-12-15 >4 A/chicken/Egypt/S4456B/2011 ATGGAAATAATACCACTGACGACTATACTACTATTAGTAACAACAA... NaN NaN NaN NaN NaN 1683
JQ770133 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 2011-12-15 >4 A/chicken/Guangdong/LJT12/2011 ATGGAAGTAGTATCACTAATAACTATACTACTAGTAATAACAGGAA... NaN NaN NaN NaN NaN 1683
JQ973658 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2011-12-15 >4 A/chicken/Israel/1115/2011 ATGGAAATAATATCACTGATGACTATACTACTGGTGGTAACAACAA... NaN NaN NaN NaN NaN 1680
JQ973660 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2011-12-15 >4 A/chicken/Israel/1164/2011 ATGGAAATAACATCACTGATGACTATACTACTAGTAATAACAACAA... NaN NaN NaN NaN NaN 1680
JQ973652 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2012-01-15 >4 A/chicken/Israel/11/2012 ATGGAAACAATATCACTGATGACTATACTACTGGTGGTAACAACAA... NaN NaN NaN NaN NaN 1680
JQ973653 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2012-01-15 >4 A/chicken/Israel/46/2012 ATGGAACCAATATCACTGATGACTATACTACTGGTGGTAACAACAA... NaN NaN NaN NaN NaN 1680
JQ973654 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2012-01-15 >4 A/chicken/Israel/50/2012 ATGGAAATAATATCACTGATGACTGTACTACTAGTAGTAACAACAA... NaN NaN NaN NaN NaN 1680
KC417046 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 2012-01-15 >4 A/chicken/Shanghai/C1/2012 ATGGAAGTAGTATCACTAATAACTATACTACTAGTAGCAACAGTAA... NaN NaN NaN NaN NaN 1683
JQ906557 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2012-02-15 >4 A/chicken/Egypt/1226B/2012 ATGGAAATAATACCACTGACGACTATACTACTATTAGTAACAACAA... NaN NaN NaN NaN NaN 1652
JQ906558 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2012-02-15 >4 A/chicken/Egypt/1231B/2012 ATGGAAATAATACCACTGATGACTGTACTGCTATTAGTAACATCAA... NaN NaN NaN NaN NaN 1652
KC817014 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 2012-02-15 >4 A/chicken/Henan/ZK2/2012 ATGGAGACAGCATCGCTGATGACTATACTACTAGTAGTAACAGTAA... NaN NaN NaN NaN NaN 1683
JX448765 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 2012-03-15 >4 A/chicken/Fujian/SN2/2012 ATGGAAGTAGTATCACTGATAACTACACTGTTAGCAGTAACAACAA... NaN NaN NaN NaN NaN 1683
JX846585 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 2012-06-15 >4 A/chicken/Henan/YX/2012 ATGGAAGTAGTATCACTAATAACTATACTACTAGTAGTAACAGTAT... NaN NaN NaN NaN NaN 1683
KC951122 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes China.Central ... 2013-01-15 >4 A/chicken/Guangdong/LG1/2013 ATGGAGACAGTATCACTAATAACTATACTACTAGTAGCAACAATAA... NaN NaN NaN NaN NaN 1683
KF918709 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2013-01-15 >4 A/chicken/Israel/74/2013 ATGGAAATAATATCACTGATGACTGTACTACTAGTAGTAACAACAA... NaN NaN NaN NaN NaN 1680
KF918708 Avian chicken Poultry Poultry Domestic animal Domestic D Chicken Galliformes Middle.East ... 2013-04-15 >4 A/chicken/Israel/502/2013 ATGGAAGCAATATCACTGATGACTATACTACTGGTGGTAACAACAA... NaN NaN NaN NaN NaN 1680
KJ128362 Avian pigeon ? Columbiformes Wild bird Wild W Other NaN E.Asia.E.China ... 2013-04-15 >4 A/pigeon/Shanghai/JC1/2013 ATGGAAGTAGTATCACTAATAACTATACTACTAGTAGCAACAGTAA... NaN NaN NaN NaN NaN 1683
AF156378 Avian ? Galliformes quail Domestic animal Domestic D Quail Galliformes China.Central ... 1997-06-15 >4 A/Quail/Hong Kong/G1/97 ATGGAAACAATATCGCTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1629
AF156380 Avian Poultry Poultry chicken Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 1994-06-15 >4 A/chicken/Beijing/1/1994 ATGGAAACAATATCACTAATAACTATACTACTAGTAGTAACAGCAA... NaN NaN NaN NaN NaN 1660
AF461532 Avian Poultry Poultry chicken Domestic animal Domestic D Chicken Galliformes E.Asia.E.China ... 1998-06-15 >4 A/Chicken/Shanghai/F/98 ATGGAAACAATATCACTAATAGCTATACTACTAGTAGTAACAGTAA... NaN NaN NaN NaN NaN 1683

638 rows × 27 columns


In [3]:
# From the data, pull out accession and sequence, and store as a list of SeqRecords.
sequences = []
for row in data.iterrows():
    sequence = SeqRecord(Seq(row[1]['Trimmed Sequence*']), 
                         id=row[0] + '_' + str(row[1]['HostType_Code1S']) + '_' + str(row[1]['Geo_Code']) + '_' + str(row[1]['HostOrder_Nic']))
    sequences.append(sequence)

In [4]:
# sequences

In [5]:
# # Function to find longest ORFs:
# def longest_orfs(list_of_seqrecords):
#     aa_sequences = []
#     for i, record in enumerate(list_of_seqrecords):
# #         print(i, record.seq)
#         longest_protein = SeqRecord(id=record.id, seq='')
#         for frame in range(3):
#             length = 3 * ((len(record) - frame) // 3)
#             translation = record.seq[frame:frame + length].translate()
#             for pro in translation.split("*"):
#                 if len(pro) > len(longest_protein.seq):
#                     longest_protein.seq = pro
#         aa_sequences.append(longest_protein)
        
#     return aa_sequences

In [6]:
# # Uncomment this cell if you need to re-write them to disk.

# # Get the longest ORFs from the sequences
# ha_orfs = longest_orfs(sequences)

# # Write the longest ORFS to disk:
# SeqIO.write(ha_orfs, 'H9N2_HA_CDS_all.fasta', 'fasta')

In [7]:
# # Perform multiple sequence alignment using Clustal Omega.
# # Uncomment this cell only if you need to run another multiple sequence alignment.

# gene = 'HA'

# in_file = "H9N2_%s_CDS_all.fasta" % gene
# out_file = "H9N2_%s_CDS_all_Aligned.fasta" % gene
# cline = ClustalOmegaCommandline(infile=in_file, outfile=out_file, verbose=True, auto=True, force=True)
# cline()

In [8]:
# Read in the aligned sequences

gene = "HA"
genes = [s for s in AlignIO.read('H9N2_%s_CDS_all_Aligned.fasta' % gene, 'fasta') if 'nan' not in s.id]
genes


Out[8]:
[SeqRecord(seq=Seq('METKALIAILLMVTTSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY031275_D_China.Central_Galliformes', name='CY031275_D_China.Central_Galliformes', description='CY031275_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTTLIAILLMVTASNADKICIGYQSTNSTETVDTLMENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF188339_W_N.Amer_Anseriformes', name='KF188339_W_N.Amer_Anseriformes', description='KF188339_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIAPIAILLMVTAGNADKICIGHQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF188287_D_Europe_Galliformes', name='KF188287_D_Europe_Galliformes', description='KF188287_D_Europe_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY005919_W_N.Amer_Anseriformes', name='CY005919_W_N.Amer_Anseriformes', description='CY005919_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLVAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY101406_W_N.Amer_Charadriiformes', name='CY101406_W_N.Amer_Charadriiformes', description='CY101406_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLVAILLMVTASNADKICIGYQSTNSTETVDTLIESNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY005986_W_N.Amer_Charadriiformes', name='CY005986_W_N.Amer_Charadriiformes', description='CY005986_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLVAILIMVTASNADKICIGYQSTNSTETVDTLIESNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY101507_W_N.Amer_Charadriiformes', name='CY101507_W_N.Amer_Charadriiformes', description='CY101507_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='AB303077_W_Europe_Anseriformes', name='AB303077_W_Europe_Anseriformes', description='AB303077_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVITASSADKICIGYQSTNSTETVDTLIESNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='AF156379_D_China.Central_Galliformes', name='AF156379_D_China.Central_Galliformes', description='AF156379_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HE802066_W_Europe_Anseriformes', name='HE802066_W_Europe_Anseriformes', description='HE802066_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JX273569_D_Europe_Galliformes', name='JX273569_D_Europe_Galliformes', description='JX273569_D_Europe_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METRTLIAALLIVTTSNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY102188_W_N.Amer_Charadriiformes', name='CY102188_W_N.Amer_Charadriiformes', description='CY102188_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLLVTTSNADKICIGYQSTNSTETVDTLAENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ064377_D_E.Asia.E.China_Galliformes', name='DQ064377_D_E.Asia.E.China_Galliformes', description='DQ064377_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILVVTKTSNADKICIGYQSTNSTETVDTLVENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='GU053186_D_E.Asia.E.China_Galliformes', name='GU053186_D_E.Asia.E.China_Galliformes', description='GU053186_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTASNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB432938_D_China.Central_Anseriformes', name='AB432938_D_China.Central_Anseriformes', description='AB432938_D_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTASNADKICIGYQSTNSTETVGTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ064360_D_China.Central_Galliformes', name='DQ064360_D_China.Central_Galliformes', description='DQ064360_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATAIITILLVITASYADKICIGYQSTNSTETVDTLTETNVPVTHTKDLLHTE...---', SingleLetterAlphabet()), id='JQ344328_D_SE.Asia_Anseriformes', name='JQ344328_D_SE.Asia_Anseriformes', description='JQ344328_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEQVSLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF800947_D_Middle.East_Galliformes', name='KF800947_D_Middle.East_Galliformes', description='KF800947_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHARELLHTE...---', SingleLetterAlphabet()), id='AF461510_D_E.Asia.E.China_Galliformes', name='AF461510_D_E.Asia.E.China_Galliformes', description='AF461510_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AY743216_D_E.Asia.E.China_Galliformes', name='AY743216_D_E.Asia.E.China_Galliformes', description='AY743216_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY081264_D_Middle.East_Galliformes', name='CY081264_D_Middle.East_Galliformes', description='CY081264_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ794817_D_Middle.East_Galliformes', name='FJ794817_D_Middle.East_Galliformes', description='FJ794817_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLLTILLVVTTSNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ419725_D_Middle.East_Galliformes', name='JQ419725_D_Middle.East_Galliformes', description='JQ419725_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEQVSLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497118_D_Middle.East_Galliformes', name='GQ497118_D_Middle.East_Galliformes', description='GQ497118_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLIVTAGNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461512_D_China.West_Galliformes', name='AF461512_D_China.West_Galliformes', description='AF461512_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITIILVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461528_D_China.West_Galliformes', name='AF461528_D_China.West_Galliformes', description='AF461528_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METRSLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF508556_D_S.Asia_Galliformes', name='AF508556_D_S.Asia_Galliformes', description='AF508556_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTESNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF508568_D_China.West_Galliformes', name='AF508568_D_China.West_Galliformes', description='AF508568_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTESNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF508571_D_E.Asia.E.China_Galliformes', name='AF508571_D_E.Asia.E.China_Galliformes', description='AF508571_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METRSLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AJ291392_D_S.Asia_Galliformes', name='AJ291392_D_S.Asia_Galliformes', description='AJ291392_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVLSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AY036880_D_China.Central_Galliformes', name='AY036880_D_China.Central_Galliformes', description='AY036880_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLMTILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ064375_D_China.West_Galliformes', name='DQ064375_D_China.West_Galliformes', description='DQ064375_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ227352_D_China.West_Galliformes', name='DQ227352_D_China.West_Galliformes', description='DQ227352_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITIPLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF070733_D_China.West_Galliformes', name='EF070733_D_China.West_Galliformes', description='EF070733_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU053201_D_Middle.East_Galliformes', name='GU053201_D_Middle.East_Galliformes', description='GU053201_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METRSLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188299_D_S.Asia_Galliformes', name='KF188299_D_S.Asia_Galliformes', description='KF188299_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497120_D_Middle.East_Galliformes', name='GQ497120_D_Middle.East_Galliformes', description='GQ497120_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGPYHTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497119_D_Middle.East_Galliformes', name='GQ497119_D_Middle.East_Galliformes', description='GQ497119_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY006021_W_E.Asia.E.China_Anseriformes', name='CY006021_W_E.Asia.E.China_Anseriformes', description='CY006021_W_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKFCIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ485208_D_China.Central_Galliformes', name='DQ485208_D_China.Central_Galliformes', description='DQ485208_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLVVTASNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY102633_W_N.Amer_Charadriiformes', name='CY102633_W_N.Amer_Charadriiformes', description='CY102633_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AY738451_D_Middle.East_Galliformes', name='AY738451_D_Middle.East_Galliformes', description='AY738451_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTVSNADKICIGYQSTNSTETVDTLTESNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461515_D_E.Asia.E.China_Galliformes', name='AF461515_D_E.Asia.E.China_Galliformes', description='AF461515_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461518_D_E.Asia.E.China_Galliformes', name='AF461518_D_E.Asia.E.China_Galliformes', description='AF461518_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAEELLHTE...---', SingleLetterAlphabet()), id='AF461519_D_E.Asia.E.China_Galliformes', name='AF461519_D_E.Asia.E.China_Galliformes', description='AF461519_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLAVTISNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461523_D_E.Asia.E.China_Galliformes', name='AF461523_D_E.Asia.E.China_Galliformes', description='AF461523_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITIILVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461529_D_China.West_Galliformes', name='AF461529_D_China.West_Galliformes', description='AF461529_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461531_D_E.Asia.E.China_Galliformes', name='AF461531_D_E.Asia.E.China_Galliformes', description='AF461531_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTASNADKICISYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AY513715_D_E.Asia.E.China_Galliformes', name='AY513715_D_E.Asia.E.China_Galliformes', description='AY513715_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY023976_D_China.Central_Galliformes', name='CY023976_D_China.Central_Galliformes', description='CY023976_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTIGNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY024568_D_China.Central_Galliformes', name='CY024568_D_China.Central_Galliformes', description='CY024568_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY024576_D_China.Central_Galliformes', name='CY024576_D_China.Central_Galliformes', description='CY024576_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASTADKICIGYQSTNSTETVDTLTESNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ064355_D_E.Asia.E.China_Galliformes', name='DQ064355_D_E.Asia.E.China_Galliformes', description='DQ064355_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ064368_D_China.Central_Galliformes', name='DQ064368_D_China.Central_Galliformes', description='DQ064368_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVLLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ064372_D_E.Asia.E.China_Galliformes', name='DQ064372_D_E.Asia.E.China_Galliformes', description='DQ064372_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063510_D_Middle.East_Galliformes', name='EF063510_D_Middle.East_Galliformes', description='EF063510_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063511_D_Middle.East_Galliformes', name='EF063511_D_Middle.East_Galliformes', description='EF063511_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063512_D_Middle.East_Galliformes', name='EF063512_D_Middle.East_Galliformes', description='EF063512_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492221_D_Middle.East_Galliformes', name='EF492221_D_Middle.East_Galliformes', description='EF492221_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILVVTETSNADKICIGYQSTNSTETVDTLVENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='EF620900_D_E.Asia.E.China_Galliformes', name='EF620900_D_E.Asia.E.China_Galliformes', description='EF620900_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU477248_D_Middle.East_Galliformes', name='EU477248_D_Middle.East_Galliformes', description='EU477248_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTAGNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU477249_D_Middle.East_Galliformes', name='EU477249_D_Middle.East_Galliformes', description='EU477249_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEQVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497122_D_Middle.East_Galliformes', name='GQ497122_D_Middle.East_Galliformes', description='GQ497122_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497123_D_Middle.East_Galliformes', name='GQ497123_D_Middle.East_Galliformes', description='GQ497123_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY006023_D_E.Asia.E.China_Galliformes', name='CY006023_D_E.Asia.E.China_Galliformes', description='CY006023_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLYTE...---', SingleLetterAlphabet()), id='AB256674_D_E.Asia.E.China_Galliformes', name='AB256674_D_E.Asia.E.China_Galliformes', description='AB256674_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLIPILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB256690_D_E.Asia.E.China_Galliformes', name='AB256690_D_E.Asia.E.China_Galliformes', description='AB256690_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB256738_D_E.Asia.E.China_Galliformes', name='AB256738_D_E.Asia.E.China_Galliformes', description='AB256738_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB256746_D_E.Asia.E.China_Galliformes', name='AB256746_D_E.Asia.E.China_Galliformes', description='AB256746_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLAVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461524_D_E.Asia.E.China_Galliformes', name='AF461524_D_E.Asia.E.China_Galliformes', description='AF461524_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METLSLTTILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY023104_D_China.Central_Galliformes', name='CY023104_D_China.Central_Galliformes', description='CY023104_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METLSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY023920_D_China.Central_Anseriformes', name='CY023920_D_China.Central_Anseriformes', description='CY023920_D_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY024696_D_China.Central_Galliformes', name='CY024696_D_China.Central_Galliformes', description='CY024696_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METLSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY024704_D_China.Central_Galliformes', name='CY024704_D_China.Central_Galliformes', description='CY024704_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METLSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY024712_D_China.Central_Galliformes', name='CY024712_D_China.Central_Galliformes', description='CY024712_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATAIITILLVITASYADKICIGYQSTNSTETVDTLTETNVPVTHTKDLLHTE...---', SingleLetterAlphabet()), id='CY073800_D_SE.Asia_Anseriformes', name='CY073800_D_SE.Asia_Anseriformes', description='CY073800_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ064367_D_E.Asia.E.China_Galliformes', name='DQ064367_D_E.Asia.E.China_Galliformes', description='DQ064367_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ681216_D_E.Asia.E.China_Anseriformes', name='DQ681216_D_E.Asia.E.China_Anseriformes', description='DQ681216_D_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063513_D_Middle.East_Galliformes', name='EF063513_D_Middle.East_Galliformes', description='EF063513_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063514_D_Middle.East_Galliformes', name='EF063514_D_Middle.East_Galliformes', description='EF063514_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF154917_D_China.Central_Galliformes', name='EF154917_D_China.Central_Galliformes', description='EF154917_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVIASNADKICIGHQSTNSTETVDTLTETNVPVTHAQELLHTE...---', SingleLetterAlphabet()), id='EF154922_D_China.Central_Galliformes', name='EF154922_D_China.Central_Galliformes', description='EF154922_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF154923_D_China.Central_Galliformes', name='EF154923_D_China.Central_Galliformes', description='EF154923_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF154924_D_China.Central_Galliformes', name='EF154924_D_China.Central_Galliformes', description='EF154924_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTPLMTILLMVTAINADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF154925_D_China.Central_Galliformes', name='EF154925_D_China.Central_Galliformes', description='EF154925_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492233_D_Middle.East_Galliformes', name='EF492233_D_Middle.East_Galliformes', description='EF492233_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='EF541419_D_SE.Asia_Anseriformes', name='EF541419_D_SE.Asia_Anseriformes', description='EF541419_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIAIIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='EF541420_D_SE.Asia_Anseriformes', name='EF541420_D_SE.Asia_Anseriformes', description='EF541420_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILVVTGTSDADKICIGYQSTNSTETVDTLVENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='EU253561_D_E.Asia.E.China_Galliformes', name='EU253561_D_E.Asia.E.China_Galliformes', description='EU253561_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATSLITILLLVTTSNADKICIGYQSTNPTETVDTLAENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190132_D_E.Asia.E.China_Galliformes', name='FJ190132_D_E.Asia.E.China_Galliformes', description='FJ190132_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTIALIAILLRAIAGNADKICIGYQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JX273541_D_Europe_Galliformes', name='JX273541_D_Europe_Galliformes', description='JX273541_D_Europe_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188352_D_Middle.East_Galliformes', name='KF188352_D_Middle.East_Galliformes', description='KF188352_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188377_D_E.Asia.E.China_Anseriformes', name='KF188377_D_E.Asia.E.China_Anseriformes', description='KF188377_D_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497124_D_Middle.East_Galliformes', name='GQ497124_D_Middle.East_Galliformes', description='GQ497124_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELIHTE...---', SingleLetterAlphabet()), id='AY738454_D_Middle.East_Galliformes', name='AY738454_D_Middle.East_Galliformes', description='AY738454_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471884_D_China.Central_Galliformes', name='GU471884_D_China.Central_Galliformes', description='GU471884_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLVVTTSNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144389_W_N.Amer_Charadriiformes', name='CY144389_W_N.Amer_Charadriiformes', description='CY144389_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLVVTTSNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144397_W_N.Amer_Charadriiformes', name='CY144397_W_N.Amer_Charadriiformes', description='CY144397_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTISNADKICIGYQSTNSTETVDTLTENNVPVTHARELLHTE...---', SingleLetterAlphabet()), id='AB256714_D_E.Asia.E.China_Galliformes', name='AB256714_D_E.Asia.E.China_Galliformes', description='AB256714_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AY949989_D_E.Asia.E.China_Galliformes', name='AY949989_D_E.Asia.E.China_Galliformes', description='AY949989_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEALSPITILLVVAVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHAE...---', SingleLetterAlphabet()), id='CY023848_D_China.West_Galliformes', name='CY023848_D_China.West_Galliformes', description='CY023848_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKFCIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY076723_D_Middle.East_Galliformes', name='CY076723_D_Middle.East_Galliformes', description='CY076723_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ997451_D_E.Asia.E.China_Anseriformes', name='DQ997451_D_E.Asia.E.China_Anseriformes', description='DQ997451_D_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063515_D_Middle.East_Galliformes', name='EF063515_D_Middle.East_Galliformes', description='EF063515_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492229_D_Middle.East_Galliformes', name='EF492229_D_Middle.East_Galliformes', description='EF492229_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU477246_D_Middle.East_Galliformes', name='EU477246_D_Middle.East_Galliformes', description='EU477246_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ384751_D_E.Asia.E.China_Galliformes', name='FJ384751_D_E.Asia.E.China_Galliformes', description='FJ384751_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU050554_D_Middle.East_Galliformes', name='GU050554_D_Middle.East_Galliformes', description='GU050554_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITALIAILLMTTTSNADKICIGYQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JX273565_W_Europe_Charadriiformes', name='JX273565_W_Europe_Charadriiformes', description='JX273565_W_Europe_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEQVSLMTVLLVATASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497125_D_Middle.East_Galliformes', name='GQ497125_D_Middle.East_Galliformes', description='GQ497125_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVATASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497126_D_Middle.East_Galliformes', name='GQ497126_D_Middle.East_Galliformes', description='GQ497126_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTTSNADKICIGYQSTNSTETVDTLAENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF916721_D_E.Asia.E.China_Anseriformes', name='JF916721_D_E.Asia.E.China_Anseriformes', description='JF916721_D_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIIILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY068643_D_S.Asia_Galliformes', name='CY068643_D_S.Asia_Galliformes', description='CY068643_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497128_D_Middle.East_Galliformes', name='GQ497128_D_Middle.East_Galliformes', description='GQ497128_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIIILLVVTTSNADKICIVHQSTNSTETVNTLTETNVPVTYAKELLHTE...---', SingleLetterAlphabet()), id='EU665420_D_S.Asia_Galliformes', name='EU665420_D_S.Asia_Galliformes', description='EU665420_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIIILLVVTTSNADKICIGHQSTNSTETVNTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU665421_D_S.Asia_Galliformes', name='EU665421_D_S.Asia_Galliformes', description='EU665421_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILL--TASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY004420_W_N.Amer_Charadriiformes', name='CY004420_W_N.Amer_Charadriiformes', description='CY004420_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILL--TASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY102720_W_N.Amer_Charadriiformes', name='CY102720_W_N.Amer_Charadriiformes', description='CY102720_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY005992_W_N.Amer_Charadriiformes', name='CY005992_W_N.Amer_Charadriiformes', description='CY005992_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSATASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144515_W_N.Amer_Charadriiformes', name='CY144515_W_N.Amer_Charadriiformes', description='CY144515_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSATASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144373_W_N.Amer_Charadriiformes', name='CY144373_W_N.Amer_Charadriiformes', description='CY144373_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSATASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144473_W_N.Amer_Charadriiformes', name='CY144473_W_N.Amer_Charadriiformes', description='CY144473_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSATASNADKICIGYQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144523_W_N.Amer_Charadriiformes', name='CY144523_W_N.Amer_Charadriiformes', description='CY144523_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144539_W_N.Amer_Charadriiformes', name='CY144539_W_N.Amer_Charadriiformes', description='CY144539_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144547_W_N.Amer_Charadriiformes', name='CY144547_W_N.Amer_Charadriiformes', description='CY144547_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144563_W_N.Amer_Charadriiformes', name='CY144563_W_N.Amer_Charadriiformes', description='CY144563_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVENNVPVTHAKELLQTE...---', SingleLetterAlphabet()), id='AY790313_D_E.Asia.E.China_Galliformes', name='AY790313_D_E.Asia.E.China_Galliformes', description='AY790313_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEILALIAILVVTGTGNADKICIGYQSTNSTETVDTLVENNVPVTHTKELLHTG...---', SingleLetterAlphabet()), id='AY862599_D_E.Asia.E.China_Galliformes', name='AY862599_D_E.Asia.E.China_Galliformes', description='AY862599_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILVVTGTGNADKICIGYQSTNSTETVDTLVENNVPVTHTKELLHTG...---', SingleLetterAlphabet()), id='AY862606_D_E.Asia.E.China_Galliformes', name='AY862606_D_E.Asia.E.China_Galliformes', description='AY862606_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKALSPITILLVVAVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHAE...---', SingleLetterAlphabet()), id='CY023872_D_China.West_Galliformes', name='CY023872_D_China.West_Galliformes', description='CY023872_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKALSPITILLVVAVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHAE...---', SingleLetterAlphabet()), id='CY023880_D_China.West_Galliformes', name='CY023880_D_China.West_Galliformes', description='CY023880_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ681203_D_E.Asia.E.China_Anseriformes', name='DQ681203_D_E.Asia.E.China_Anseriformes', description='DQ681203_D_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063516_D_Middle.East_Galliformes', name='EF063516_D_Middle.East_Galliformes', description='EF063516_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVATASNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063725_D_Middle.East_Galliformes', name='EF063725_D_Middle.East_Galliformes', description='EF063725_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063726_D_Middle.East_Galliformes', name='EF063726_D_Middle.East_Galliformes', description='EF063726_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVATASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FN600115_W_Middle.East_Anseriformes', name='FN600115_W_Middle.East_Anseriformes', description='FN600115_W_Middle.East_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVGTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM008896_D_E.Asia.E.China_Galliformes', name='HM008896_D_E.Asia.E.China_Galliformes', description='HM008896_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM008897_D_E.Asia.E.China_Galliformes', name='HM008897_D_E.Asia.E.China_Galliformes', description='HM008897_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLLVTTSNADKICIGYQSTNSTETVDTLAENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM008898_D_E.Asia.E.China_Galliformes', name='HM008898_D_E.Asia.E.China_Galliformes', description='HM008898_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIIILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273542_D_S.Asia_Galliformes', name='JX273542_D_S.Asia_Galliformes', description='JX273542_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLVITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273552_D_S.Asia_Galliformes', name='JX273552_D_S.Asia_Galliformes', description='JX273552_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273553_D_S.Asia_Galliformes', name='JX273553_D_S.Asia_Galliformes', description='JX273553_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF188256_W_N.Amer_Charadriiformes', name='KF188256_W_N.Amer_Charadriiformes', description='KF188256_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSTTASNADKICIGYQSTNSTETVDTLMENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF188278_W_N.Amer_Charadriiformes', name='KF188278_W_N.Amer_Charadriiformes', description='KF188278_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188304_D_China.Central_Galliformes', name='KF188304_D_China.Central_Galliformes', description='KF188304_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVATASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497127_D_Middle.East_Galliformes', name='GQ497127_D_Middle.East_Galliformes', description='GQ497127_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKVVSLITILLAVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB634251_D_E.Asia.E.China_Galliformes', name='AB634251_D_E.Asia.E.China_Galliformes', description='AB634251_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF746785_D_E.Asia.E.China_Galliformes', name='KF746785_D_E.Asia.E.China_Galliformes', description='KF746785_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLMTILLMVTVINADKICIGYQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='CY024320_D_China.Central_Galliformes', name='CY024320_D_China.Central_Galliformes', description='CY024320_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ464352_D_E.Asia.E.China_Galliformes', name='DQ464352_D_E.Asia.E.China_Galliformes', description='DQ464352_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ465400_D_China.Central_Anseriformes', name='DQ465400_D_China.Central_Anseriformes', description='DQ465400_D_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILGVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='DQ885991_D_E.Asia.E.China_Galliformes', name='DQ885991_D_E.Asia.E.China_Galliformes', description='DQ885991_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHARELLHTE...---', SingleLetterAlphabet()), id='EF063729_D_Middle.East_Galliformes', name='EF063729_D_Middle.East_Galliformes', description='EF063729_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVATASNADKICIGHQSTNSTETVDTLTETNVPVTDAKELLHTE...---', SingleLetterAlphabet()), id='EF063730_D_Middle.East_Galliformes', name='EF063730_D_Middle.East_Galliformes', description='EF063730_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063731_D_Middle.East_Galliformes', name='EF063731_D_Middle.East_Galliformes', description='EF063731_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492242_D_Middle.East_Galliformes', name='EF492242_D_Middle.East_Galliformes', description='EF492242_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU662946_D_E.Asia.E.China_Galliformes', name='EU662946_D_E.Asia.E.China_Galliformes', description='EU662946_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU662947_D_E.Asia.E.China_Galliformes', name='EU662947_D_E.Asia.E.China_Galliformes', description='EU662947_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273537_D_Middle.East_Anseriformes', name='JX273537_D_Middle.East_Anseriformes', description='JX273537_D_Middle.East_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273545_D_Middle.East_Galliformes', name='JX273545_D_Middle.East_Galliformes', description='JX273545_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273546_D_Middle.East_Galliformes', name='JX273546_D_Middle.East_Galliformes', description='JX273546_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188395_D_E.Asia.E.China_Galliformes', name='KF188395_D_E.Asia.E.China_Galliformes', description='KF188395_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188399_D_S.Asia_Galliformes', name='KF188399_D_S.Asia_Galliformes', description='KF188399_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF746835_D_E.Asia.E.China_Galliformes', name='KF746835_D_E.Asia.E.China_Galliformes', description='KF746835_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='CY038410_D_S.Asia_Galliformes', name='CY038410_D_S.Asia_Galliformes', description='CY038410_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METLSIITILLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY023416_D_China.Central_Galliformes', name='CY023416_D_China.Central_Galliformes', description='CY023416_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLIVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY023424_D_China.Central_Galliformes', name='CY023424_D_China.Central_Galliformes', description='CY023424_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY023608_D_E.Asia.E.China_Galliformes', name='CY023608_D_E.Asia.E.China_Galliformes', description='CY023608_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY023680_D_E.Asia.E.China_Galliformes', name='CY023680_D_E.Asia.E.China_Galliformes', description='CY023680_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLMTILLMVTAINADKICIGYQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='CY024504_D_China.Central_Galliformes', name='CY024504_D_China.Central_Galliformes', description='CY024504_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKITALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY043856_W_Europe_Anseriformes', name='CY043856_W_Europe_Anseriformes', description='CY043856_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063733_D_Middle.East_Galliformes', name='EF063733_D_Middle.East_Galliformes', description='EF063733_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF063734_D_Middle.East_Galliformes', name='EF063734_D_Middle.East_Galliformes', description='EF063734_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF154968_D_China.Central_Galliformes', name='EF154968_D_China.Central_Galliformes', description='EF154968_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLMTILLMVTAINADKICIGYQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='EF154976_D_China.Central_Galliformes', name='EF154976_D_China.Central_Galliformes', description='EF154976_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492222_D_Middle.East_Galliformes', name='EF492222_D_Middle.East_Galliformes', description='EF492222_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492225_D_Middle.East_Galliformes', name='EF492225_D_Middle.East_Galliformes', description='EF492225_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHAE...---', SingleLetterAlphabet()), id='EF492230_D_Middle.East_Galliformes', name='EF492230_D_Middle.East_Galliformes', description='EF492230_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTAINADKICIGYQSTNSTEAVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492234_D_Middle.East_Galliformes', name='EF492234_D_Middle.East_Galliformes', description='EF492234_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTAINADKICIGYQSTNSTEAVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492236_D_Middle.East_Galliformes', name='EF492236_D_Middle.East_Galliformes', description='EF492236_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273556_D_Middle.East_Galliformes', name='JX273556_D_Middle.East_Galliformes', description='JX273556_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188254_D_Middle.East_Galliformes', name='KF188254_D_Middle.East_Galliformes', description='KF188254_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVATSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188325_D_S.Asia_Galliformes', name='KF188325_D_S.Asia_Galliformes', description='KF188325_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MGTTSLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188337_W_Middle.East_Charadriiformes', name='KF188337_W_Middle.East_Charadriiformes', description='KF188337_W_Middle.East_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188347_D_S.Asia_Galliformes', name='KF188347_D_S.Asia_Galliformes', description='KF188347_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVATSNADKICVGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188359_D_S.Asia_Galliformes', name='KF188359_D_S.Asia_Galliformes', description='KF188359_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188371_W_Middle.East_Charadriiformes', name='KF188371_W_Middle.East_Charadriiformes', description='KF188371_W_Middle.East_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLAVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259064_D_China.Central_Galliformes', name='KF259064_D_China.Central_Galliformes', description='KF259064_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLSTTAINADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY075925_W_N.Amer_Charadriiformes', name='CY075925_W_N.Amer_Charadriiformes', description='CY075925_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KC209500_W_E.Asia.E.China_Anseriformes', name='KC209500_W_E.Asia.E.China_Anseriformes', description='KC209500_W_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEQLSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497131_D_Middle.East_Galliformes', name='GQ497131_D_Middle.East_Galliformes', description='GQ497131_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038442_D_S.Asia_Galliformes', name='CY038442_D_S.Asia_Galliformes', description='CY038442_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038418_D_S.Asia_Galliformes', name='CY038418_D_S.Asia_Galliformes', description='CY038418_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU722360_D_China.Central_Galliformes', name='GU722360_D_China.Central_Galliformes', description='GU722360_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILVMTGTGNADKICIGYQSTNSTETVDTLVENNVPVTHTKELLRTE...---', SingleLetterAlphabet()), id='GU247915_D_E.Asia.E.China_Galliformes', name='GU247915_D_E.Asia.E.China_Galliformes', description='GU247915_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN540058_D_S.Asia_Galliformes', name='JN540058_D_S.Asia_Galliformes', description='JN540058_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU722362_D_China.Central_Galliformes', name='GU722362_D_China.Central_Galliformes', description='GU722362_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038426_D_S.Asia_Galliformes', name='CY038426_D_S.Asia_Galliformes', description='CY038426_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY041426_W_N.Amer_Charadriiformes', name='CY041426_W_N.Amer_Charadriiformes', description='CY041426_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY043912_W_N.Amer_Charadriiformes', name='CY043912_W_N.Amer_Charadriiformes', description='CY043912_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY041434_W_N.Amer_Charadriiformes', name='CY041434_W_N.Amer_Charadriiformes', description='CY041434_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTIALIAILLSTTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144699_W_N.Amer_Charadriiformes', name='CY144699_W_N.Amer_Charadriiformes', description='CY144699_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497134_D_Middle.East_Galliformes', name='GQ497134_D_Middle.East_Galliformes', description='GQ497134_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471895_D_China.Central_Galliformes', name='GU471895_D_China.Central_Galliformes', description='GU471895_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY041266_W_Europe_Anseriformes', name='CY041266_W_Europe_Anseriformes', description='CY041266_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY043864_W_Europe_Anseriformes', name='CY043864_W_Europe_Anseriformes', description='CY043864_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLISTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EF492224_D_Middle.East_Galliformes', name='EF492224_D_Middle.East_Galliformes', description='EF492224_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKALSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU086283_D_E.Asia.E.China_Galliformes', name='EU086283_D_E.Asia.E.China_Galliformes', description='EU086283_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METI----SLIVITVSNADKICIGYLSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU157934_D_China.West_Galliformes', name='EU157934_D_China.West_Galliformes', description='EU157934_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLLTILLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216085_D_China.West_Galliformes', name='EU216085_D_China.West_Galliformes', description='EU216085_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('----METISLLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216088_D_China.West_Galliformes', name='EU216088_D_China.West_Galliformes', description='EU216088_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU573941_D_E.Asia.E.China_Galliformes', name='EU573941_D_E.Asia.E.China_Galliformes', description='EU573941_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTILLVVTTSNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTV...---', SingleLetterAlphabet()), id='FJ464730_D_Middle.East_Galliformes', name='FJ464730_D_Middle.East_Galliformes', description='FJ464730_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ373075_D_E.Asia.E.China_Galliformes', name='GQ373075_D_E.Asia.E.China_Galliformes', description='GQ373075_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273538_D_Middle.East_Anseriformes', name='JX273538_D_Middle.East_Anseriformes', description='JX273538_D_Middle.East_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273555_D_Middle.East_Galliformes', name='JX273555_D_Middle.East_Galliformes', description='JX273555_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273559_D_Middle.East_Galliformes', name='JX273559_D_Middle.East_Galliformes', description='JX273559_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273560_D_Middle.East_Galliformes', name='JX273560_D_Middle.East_Galliformes', description='JX273560_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JX273566_W_Europe_Anseriformes', name='JX273566_W_Europe_Anseriformes', description='JX273566_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTVSYADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188375_D_Middle.East_Galliformes', name='KF188375_D_Middle.East_Galliformes', description='KF188375_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIVSLITILLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259069_D_China.Central_Galliformes', name='KF259069_D_China.Central_Galliformes', description='KF259069_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259071_D_China.Central_Galliformes', name='KF259071_D_China.Central_Galliformes', description='KF259071_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259073_D_China.Central_Galliformes', name='KF259073_D_China.Central_Galliformes', description='KF259073_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSPITILLVITVSNADKICIGYQSTNSTETVDTLIENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259075_D_China.Central_Galliformes', name='KF259075_D_China.Central_Galliformes', description='KF259075_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038402_D_S.Asia_Galliformes', name='CY038402_D_S.Asia_Galliformes', description='CY038402_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAASLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAQELLHTE...---', SingleLetterAlphabet()), id='FJ190135_D_E.Asia.E.China_Galliformes', name='FJ190135_D_E.Asia.E.China_Galliformes', description='FJ190135_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKALSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU722363_D_China.Central_Galliformes', name='GU722363_D_China.Central_Galliformes', description='GU722363_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEQLSLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497133_D_Middle.East_Galliformes', name='GQ497133_D_Middle.East_Galliformes', description='GQ497133_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ464728_D_Middle.East_Galliformes', name='FJ464728_D_Middle.East_Galliformes', description='FJ464728_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ464729_D_Middle.East_Galliformes', name='FJ464729_D_Middle.East_Galliformes', description='FJ464729_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ464714_D_Middle.East_Galliformes', name='FJ464714_D_Middle.East_Galliformes', description='FJ464714_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038434_D_S.Asia_Galliformes', name='CY038434_D_S.Asia_Galliformes', description='CY038434_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTIALIAILLSTTANNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY144763_W_N.Amer_Charadriiformes', name='CY144763_W_N.Amer_Charadriiformes', description='CY144763_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038482_D_S.Asia_Galliformes', name='CY038482_D_S.Asia_Galliformes', description='CY038482_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTIALIAILLSTTANNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY077174_W_N.Amer_Charadriiformes', name='CY077174_W_N.Amer_Charadriiformes', description='CY077174_W_N.Amer_Charadriiformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSIADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038394_D_S.Asia_Galliformes', name='CY038394_D_S.Asia_Galliformes', description='CY038394_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLATTTSNADKICIGYQSTNSTETVDTLMESNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='AB874675_W_E.Asia.E.China_Anseriformes', name='AB874675_W_E.Asia.E.China_Anseriformes', description='AB874675_W_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY041274_W_Europe_Anseriformes', name='CY041274_W_Europe_Anseriformes', description='CY041274_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('----METISLLVITVSNADKICIGYQSTNSTETVNTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216080_D_China.West_Galliformes', name='EU216080_D_China.West_Galliformes', description='EU216080_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('----METISLLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216081_D_China.West_Galliformes', name='EU216081_D_China.West_Galliformes', description='EU216081_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('----METISLLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216082_D_China.West_Galliformes', name='EU216082_D_China.West_Galliformes', description='EU216082_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METI----SLIVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216083_D_China.West_Galliformes', name='EU216083_D_China.West_Galliformes', description='EU216083_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('----METISLLVKTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216084_D_China.West_Galliformes', name='EU216084_D_China.West_Galliformes', description='EU216084_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('----METISLLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216086_D_China.West_Galliformes', name='EU216086_D_China.West_Galliformes', description='EU216086_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLLNMQLVVTVSNADEICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216087_D_China.West_Galliformes', name='EU216087_D_China.West_Galliformes', description='EU216087_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216089_D_China.West_Galliformes', name='EU216089_D_China.West_Galliformes', description='EU216089_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216090_D_China.West_Galliformes', name='EU216090_D_China.West_Galliformes', description='EU216090_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLLTMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216091_D_China.West_Galliformes', name='EU216091_D_China.West_Galliformes', description='EU216091_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLLTMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU216092_D_China.West_Galliformes', name='EU216092_D_China.West_Galliformes', description='EU216092_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLIVTTSNADKICIGHQSTNSTETVDTLAETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU477243_D_Middle.East_Galliformes', name='EU477243_D_Middle.East_Galliformes', description='EU477243_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU477539_D_Middle.East_Galliformes', name='EU477539_D_Middle.East_Galliformes', description='EU477539_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU644482_D_China.West_Anseriformes', name='EU644482_D_China.West_Anseriformes', description='EU644482_D_China.West_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU644485_D_China.West_Galliformes', name='EU644485_D_China.West_Galliformes', description='EU644485_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='FN600116_W_Middle.East_Anseriformes', name='FN600116_W_Middle.East_Anseriformes', description='FN600116_W_Middle.East_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='FN600117_W_Middle.East_Anseriformes', name='FN600117_W_Middle.East_Anseriformes', description='FN600117_W_Middle.East_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTMSNAGKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM008887_D_E.Asia.E.China_Galliformes', name='HM008887_D_E.Asia.E.China_Galliformes', description='HM008887_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273539_D_S.Asia_Galliformes', name='JX273539_D_S.Asia_Galliformes', description='JX273539_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIIILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTG...---', SingleLetterAlphabet()), id='JX273540_D_S.Asia_Galliformes', name='JX273540_D_S.Asia_Galliformes', description='JX273540_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTATSSADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JX273568_W_Europe_Anseriformes', name='JX273568_W_Europe_Anseriformes', description='JX273568_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVINADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259078_D_China.Central_Galliformes', name='KF259078_D_China.Central_Galliformes', description='KF259078_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259079_D_China.Central_Galliformes', name='KF259079_D_China.Central_Galliformes', description='KF259079_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLIAMLLVVTVSNADKICIGYQSTNSTETVDTLTESNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259083_D_China.Central_Galliformes', name='KF259083_D_China.Central_Galliformes', description='KF259083_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259084_D_China.Central_Galliformes', name='KF259084_D_China.Central_Galliformes', description='KF259084_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259089_D_China.Central_Galliformes', name='KF259089_D_China.Central_Galliformes', description='KF259089_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPATHAKELLHTE...---', SingleLetterAlphabet()), id='GU471799_D_China.West_Galliformes', name='GU471799_D_China.West_Galliformes', description='GU471799_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLVVTASNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497135_D_Middle.East_Galliformes', name='GQ497135_D_Middle.East_Galliformes', description='GQ497135_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JF745931_W_Europe_Anseriformes', name='JF745931_W_Europe_Anseriformes', description='JF745931_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVATTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='GU194479_W_Europe_Anseriformes', name='GU194479_W_Europe_Anseriformes', description='GU194479_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='GU194485_W_Europe_Anseriformes', name='GU194485_W_Europe_Anseriformes', description='GU194485_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190151_D_E.Asia.E.China_Galliformes', name='FJ190151_D_E.Asia.E.China_Galliformes', description='FJ190151_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190144_D_E.Asia.E.China_Galliformes', name='FJ190144_D_E.Asia.E.China_Galliformes', description='FJ190144_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MAIIVLIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='GU194480_W_Europe_Anseriformes', name='GU194480_W_Europe_Anseriformes', description='GU194480_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='GU194481_W_Europe_Anseriformes', name='GU194481_W_Europe_Anseriformes', description='GU194481_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTGNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ497136_D_Middle.East_Galliformes', name='GQ497136_D_Middle.East_Galliformes', description='GQ497136_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190137_D_E.Asia.E.China_Galliformes', name='FJ190137_D_E.Asia.E.China_Galliformes', description='FJ190137_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ464726_D_Middle.East_Galliformes', name='FJ464726_D_Middle.East_Galliformes', description='FJ464726_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAASLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAQELLHTE...---', SingleLetterAlphabet()), id='FJ190136_D_E.Asia.E.China_Galliformes', name='FJ190136_D_E.Asia.E.China_Galliformes', description='FJ190136_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ120560_D_Middle.East_Galliformes', name='GQ120560_D_Middle.East_Galliformes', description='GQ120560_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ120559_D_Middle.East_Galliformes', name='GQ120559_D_Middle.East_Galliformes', description='GQ120559_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAASLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAQELLHTE...---', SingleLetterAlphabet()), id='FJ190149_D_China.West_Galliformes', name='FJ190149_D_China.West_Galliformes', description='FJ190149_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471894_D_China.Central_Galliformes', name='GU471894_D_China.Central_Galliformes', description='GU471894_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEKTTLIAILLMVTASNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KC693645_W_E.Asia.E.China_Anseriformes', name='KC693645_W_E.Asia.E.China_Anseriformes', description='KC693645_W_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEKIPLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY038450_D_S.Asia_Galliformes', name='CY038450_D_S.Asia_Galliformes', description='CY038450_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ464727_D_Middle.East_Galliformes', name='FJ464727_D_Middle.East_Galliformes', description='FJ464727_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ120561_D_Middle.East_Galliformes', name='GQ120561_D_Middle.East_Galliformes', description='GQ120561_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIVLIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLYTE...---', SingleLetterAlphabet()), id='GU194486_W_Europe_Anseriformes', name='GU194486_W_Europe_Anseriformes', description='GU194486_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVASLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ534538_D_China.Central_Galliformes', name='FJ534538_D_China.Central_Galliformes', description='FJ534538_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='GU194487_W_Europe_Anseriformes', name='GU194487_W_Europe_Anseriformes', description='GU194487_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX456177_D_Middle.East_Galliformes', name='JX456177_D_Middle.East_Galliformes', description='JX456177_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTDTVDTLTETNIPVTQAKELLHTE...---', SingleLetterAlphabet()), id='CY038466_D_S.Asia_Galliformes', name='CY038466_D_S.Asia_Galliformes', description='CY038466_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MGKIPLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN540066_D_S.Asia_Galliformes', name='JN540066_D_S.Asia_Galliformes', description='JN540066_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTDTVDTLTETNIPVTQAKELLHTE...---', SingleLetterAlphabet()), id='CY038474_D_S.Asia_Galliformes', name='CY038474_D_S.Asia_Galliformes', description='CY038474_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190138_D_E.Asia.E.China_Galliformes', name='FJ190138_D_E.Asia.E.China_Galliformes', description='FJ190138_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU064951_D_S.Asia_Galliformes', name='GU064951_D_S.Asia_Galliformes', description='GU064951_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273543_D_Middle.East_Galliformes', name='JX273543_D_Middle.East_Galliformes', description='JX273543_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITVSNADKICIGYQSTNSTETVNTLTEDNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188397_D_China.Central_Galliformes', name='KF188397_D_China.Central_Galliformes', description='KF188397_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVPLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259097_D_China.Central_Galliformes', name='KF259097_D_China.Central_Galliformes', description='KF259097_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLIVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259098_D_China.Central_Galliformes', name='KF259098_D_China.Central_Galliformes', description='KF259098_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GQ120552_D_Middle.East_Galliformes', name='GQ120552_D_Middle.East_Galliformes', description='GQ120552_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVTTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTG...---', SingleLetterAlphabet()), id='KF746867_D_China.Central_Galliformes', name='KF746867_D_China.Central_Galliformes', description='KF746867_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471880_D_China.Central_Galliformes', name='GU471880_D_China.Central_Galliformes', description='GU471880_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVATVINADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471881_D_China.Central_Galliformes', name='GU471881_D_China.Central_Galliformes', description='GU471881_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='GU194482_W_Europe_Anseriformes', name='GU194482_W_Europe_Anseriformes', description='GU194482_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMITASNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY079646_W_N.Amer_Anseriformes', name='CY079646_W_N.Amer_Anseriformes', description='CY079646_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLVTILLVVTTSNADKICIGHQSTNSTETVDTLTEANVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU071967_D_Middle.East_Galliformes', name='GU071967_D_Middle.East_Galliformes', description='GU071967_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLVTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU071968_D_Middle.East_Galliformes', name='GU071968_D_Middle.East_Galliformes', description='GU071968_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLMVTTSDADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY157025_W_N.Amer_Anseriformes', name='CY157025_W_N.Amer_Anseriformes', description='CY157025_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX456179_D_Middle.East_Galliformes', name='JX456179_D_Middle.East_Galliformes', description='JX456179_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC757788_D_S.Asia_Anseriformes', name='KC757788_D_S.Asia_Anseriformes', description='KC757788_D_S.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC757967_D_S.Asia_Galliformes', name='KC757967_D_S.Asia_Galliformes', description='KC757967_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU086234_D_E.Asia.E.China_Galliformes', name='GU086234_D_E.Asia.E.China_Galliformes', description='GU086234_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKSIVLIAILLVATTSNADKICIGYQSTNSTETVDTLIESNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='AB545591_D_SE.Asia_Anseriformes', name='AB545591_D_SE.Asia_Anseriformes', description='AB545591_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='HE802723_W_Europe_Anseriformes', name='HE802723_W_Europe_Anseriformes', description='HE802723_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTGNADKICVGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273549_D_S.Asia_Galliformes', name='JX273549_D_S.Asia_Galliformes', description='JX273549_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF188249_D_S.Asia_Galliformes', name='KF188249_D_S.Asia_Galliformes', description='KF188249_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVLLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259108_D_China.Central_Galliformes', name='KF259108_D_China.Central_Galliformes', description='KF259108_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY116614_W_Europe_Anseriformes', name='CY116614_W_Europe_Anseriformes', description='CY116614_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY116616_W_Europe_Anseriformes', name='CY116616_W_Europe_Anseriformes', description='CY116616_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY116618_W_Europe_Anseriformes', name='CY116618_W_Europe_Anseriformes', description='CY116618_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY116620_W_Europe_Anseriformes', name='CY116620_W_Europe_Anseriformes', description='CY116620_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF746819_D_E.Asia.E.China_Galliformes', name='KF746819_D_E.Asia.E.China_Galliformes', description='KF746819_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLGVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471868_D_E.Asia.E.China_Galliformes', name='GU471868_D_E.Asia.E.China_Galliformes', description='GU471868_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVATVINADEICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471870_D_E.Asia.E.China_Galliformes', name='GU471870_D_E.Asia.E.China_Galliformes', description='GU471870_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471803_D_China.West_Galliformes', name='GU471803_D_China.West_Galliformes', description='GU471803_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY087171_D_China.West_Galliformes', name='CY087171_D_China.West_Galliformes', description='CY087171_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY087179_D_China.West_Galliformes', name='CY087179_D_China.West_Galliformes', description='CY087179_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY087187_D_China.West_Anseriformes', name='CY087187_D_China.West_Anseriformes', description='CY087187_D_China.West_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471800_D_China.West_Galliformes', name='GU471800_D_China.West_Galliformes', description='GU471800_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNAGKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU471804_D_China.West_Galliformes', name='GU471804_D_China.West_Galliformes', description='GU471804_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF746843_D_China.Central_Galliformes', name='KF746843_D_China.Central_Galliformes', description='KF746843_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLIATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF746769_D_E.Asia.E.China_Galliformes', name='KF746769_D_E.Asia.E.China_Galliformes', description='KF746769_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLMATTSNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY157502_W_N.Amer_Anseriformes', name='CY157502_W_N.Amer_Anseriformes', description='CY157502_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLMVTTSNADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY157510_W_N.Amer_Anseriformes', name='CY157510_W_N.Amer_Anseriformes', description='CY157510_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNIPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JN540074_D_S.Asia_Galliformes', name='JN540074_D_S.Asia_Galliformes', description='JN540074_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTTLIAILLMATASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY097630_W_N.Amer_Anseriformes', name='CY097630_W_N.Amer_Anseriformes', description='CY097630_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY146513_W_N.Amer_Anseriformes', name='CY146513_W_N.Amer_Anseriformes', description='CY146513_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC757999_D_S.Asia_Galliformes', name='KC757999_D_S.Asia_Galliformes', description='KC757999_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC296446_D_China.Central_Galliformes', name='KC296446_D_China.Central_Galliformes', description='KC296446_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTDTVDTLTETNIPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JQ905259_D_S.Asia_Galliformes', name='JQ905259_D_S.Asia_Galliformes', description='JQ905259_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKSIALIAILLVTTSSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='AB569975_D_SE.Asia_Anseriformes', name='AB569975_D_SE.Asia_Anseriformes', description='AB569975_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVITTSNADRICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273547_D_S.Asia_Galliformes', name='JX273547_D_S.Asia_Galliformes', description='JX273547_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVITTSNADRICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273548_D_S.Asia_Galliformes', name='JX273548_D_S.Asia_Galliformes', description='JX273548_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JX273557_D_Middle.East_Galliformes', name='JX273557_D_Middle.East_Galliformes', description='JX273557_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JX273558_D_Middle.East_Galliformes', name='JX273558_D_Middle.East_Galliformes', description='JX273558_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX448753_D_E.Asia.E.China_Galliformes', name='JX448753_D_E.Asia.E.China_Galliformes', description='JX448753_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVLLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259116_D_China.Central_Galliformes', name='KF259116_D_China.Central_Galliformes', description='KF259116_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITVSNADKICIGYQSTNSTETVNTLTEDNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259122_D_China.Central_Galliformes', name='KF259122_D_China.Central_Galliformes', description='KF259122_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY130453_W_N.Amer_Anseriformes', name='CY130453_W_N.Amer_Anseriformes', description='CY130453_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC757832_D_S.Asia_Galliformes', name='KC757832_D_S.Asia_Galliformes', description='KC757832_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC758060_D_S.Asia_Galliformes', name='KC758060_D_S.Asia_Galliformes', description='KC758060_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY125750_W_N.Amer_Anseriformes', name='CY125750_W_N.Amer_Anseriformes', description='CY125750_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC758030_D_S.Asia_Galliformes', name='KC758030_D_S.Asia_Galliformes', description='KC758030_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY125733_W_N.Amer_Anseriformes', name='CY125733_W_N.Amer_Anseriformes', description='CY125733_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLTETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY125758_W_N.Amer_Anseriformes', name='CY125758_W_N.Amer_Anseriformes', description='CY125758_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSHADKICIGYQSTNSTETVDTLTENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF591855_D_SE.Asia_Anseriformes', name='KF591855_D_SE.Asia_Anseriformes', description='KF591855_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLMTILLLVTTSNADKICIGHQSTNSTETVDTLTENNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC757951_D_S.Asia_Galliformes', name='KC757951_D_S.Asia_Galliformes', description='KC757951_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC757991_D_S.Asia_Galliformes', name='KC757991_D_S.Asia_Galliformes', description='KC757991_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLITILLVITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX310065_D_S.Asia_Galliformes', name='JX310065_D_S.Asia_Galliformes', description='JX310065_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MATISLITILLVITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX310066_D_S.Asia_Galliformes', name='JX310066_D_S.Asia_Galliformes', description='JX310066_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLITILLVITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX310067_D_S.Asia_Galliformes', name='JX310067_D_S.Asia_Galliformes', description='JX310067_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC757855_D_S.Asia_Galliformes', name='KC757855_D_S.Asia_Galliformes', description='KC757855_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILMTILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY133373_W_N.Amer_Anseriformes', name='CY133373_W_N.Amer_Anseriformes', description='CY133373_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLIAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX456180_D_Middle.East_Galliformes', name='JX456180_D_Middle.East_Galliformes', description='JX456180_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY133633_W_N.Amer_Anseriformes', name='CY133633_W_N.Amer_Anseriformes', description='CY133633_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF800938_D_Middle.East_Galliformes', name='KF800938_D_Middle.East_Galliformes', description='KF800938_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX456182_D_Middle.East_Galliformes', name='JX456182_D_Middle.East_Galliformes', description='JX456182_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN653611_D_E.Asia.E.China_Galliformes', name='JN653611_D_E.Asia.E.China_Galliformes', description='JN653611_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC757840_D_S.Asia_Galliformes', name='KC757840_D_S.Asia_Galliformes', description='KC757840_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KJ419947_D_E.Asia.E.China_Galliformes', name='KJ419947_D_E.Asia.E.China_Galliformes', description='KJ419947_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC758015_D_S.Asia_Galliformes', name='KC758015_D_S.Asia_Galliformes', description='KC758015_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN828570_D_Middle.East_Galliformes', name='JN828570_D_Middle.East_Galliformes', description='JN828570_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTTSNADRICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX273551_D_S.Asia_Galliformes', name='JX273551_D_S.Asia_Galliformes', description='JX273551_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JX273561_D_Middle.East_Galliformes', name='JX273561_D_Middle.East_Galliformes', description='JX273561_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MGAISLMTILLVVTTSNADKICIGHQSTNSTETVNTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JX273562_D_Middle.East_Galliformes', name='JX273562_D_Middle.East_Galliformes', description='JX273562_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIVILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JX273570_D_Europe_Galliformes', name='JX273570_D_Europe_Galliformes', description='JX273570_D_Europe_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC757893_D_S.Asia_Galliformes', name='KC757893_D_S.Asia_Galliformes', description='KC757893_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVTLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC758106_D_S.Asia_Galliformes', name='KC758106_D_S.Asia_Galliformes', description='KC758106_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='KC555089_D_Middle.East_Anseriformes', name='KC555089_D_Middle.East_Anseriformes', description='KC555089_D_Middle.East_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC555097_D_Middle.East_Galliformes', name='KC555097_D_Middle.East_Galliformes', description='KC555097_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLTTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ440373_D_Middle.East_Galliformes', name='JQ440373_D_Middle.East_Galliformes', description='JQ440373_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLRAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KJ013297_W_E.Asia.E.China_Anseriformes', name='KJ013297_W_E.Asia.E.China_Anseriformes', description='KJ013297_W_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY157518_W_N.Amer_Anseriformes', name='CY157518_W_N.Amer_Anseriformes', description='CY157518_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF971949_W_China.Central_Anseriformes', name='KF971949_W_China.Central_Anseriformes', description='KF971949_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF971957_W_China.Central_Anseriformes', name='KF971957_W_China.Central_Anseriformes', description='KF971957_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF971965_W_China.Central_Anseriformes', name='KF971965_W_China.Central_Anseriformes', description='KF971965_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF971973_W_China.Central_Anseriformes', name='KF971973_W_China.Central_Anseriformes', description='KF971973_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF971981_W_China.Central_Anseriformes', name='KF971981_W_China.Central_Anseriformes', description='KF971981_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLMENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF971989_W_China.Central_Anseriformes', name='KF971989_W_China.Central_Anseriformes', description='KF971989_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLMENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF971997_W_China.Central_Anseriformes', name='KF971997_W_China.Central_Anseriformes', description='KF971997_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVATVSNADKICIGYQSTNSTETVDTLTESNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KJ419953_D_E.Asia.E.China_Galliformes', name='KJ419953_D_E.Asia.E.China_Galliformes', description='KJ419953_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX456181_D_Middle.East_Galliformes', name='JX456181_D_Middle.East_Galliformes', description='JX456181_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLIIILLLVATSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC757824_D_S.Asia_Galliformes', name='KC757824_D_S.Asia_Galliformes', description='KC757824_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METITLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTD...---', SingleLetterAlphabet()), id='KC758037_D_S.Asia_Galliformes', name='KC758037_D_S.Asia_Galliformes', description='KC758037_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY157526_W_N.Amer_Anseriformes', name='CY157526_W_N.Amer_Anseriformes', description='CY157526_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF714775_D_China.Central_Galliformes', name='KF714775_D_China.Central_Galliformes', description='KF714775_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLPTE...---', SingleLetterAlphabet()), id='JX294920_D_Middle.East_Galliformes', name='JX294920_D_Middle.East_Galliformes', description='JX294920_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLPTE...---', SingleLetterAlphabet()), id='JX294921_D_Middle.East_Galliformes', name='JX294921_D_Middle.East_Galliformes', description='JX294921_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTVLLLVTSSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF998208_D_Middle.East_Galliformes', name='KF998208_D_Middle.East_Galliformes', description='KF998208_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972005_W_China.Central_Anseriformes', name='KF972005_W_China.Central_Anseriformes', description='KF972005_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972013_W_China.Central_Anseriformes', name='KF972013_W_China.Central_Anseriformes', description='KF972013_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972021_W_China.Central_Anseriformes', name='KF972021_W_China.Central_Anseriformes', description='KF972021_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLXENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972029_W_China.Central_Anseriformes', name='KF972029_W_China.Central_Anseriformes', description='KF972029_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972037_W_China.Central_Anseriformes', name='KF972037_W_China.Central_Anseriformes', description='KF972037_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972045_W_China.Central_Anseriformes', name='KF972045_W_China.Central_Anseriformes', description='KF972045_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972053_W_China.Central_Anseriformes', name='KF972053_W_China.Central_Anseriformes', description='KF972053_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972061_W_China.Central_Anseriformes', name='KF972061_W_China.Central_Anseriformes', description='KF972061_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLMENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972069_W_China.Central_Anseriformes', name='KF972069_W_China.Central_Anseriformes', description='KF972069_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLMENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972077_W_China.Central_Anseriformes', name='KF972077_W_China.Central_Anseriformes', description='KF972077_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972085_W_China.Central_Anseriformes', name='KF972085_W_China.Central_Anseriformes', description='KF972085_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972093_W_China.Central_Anseriformes', name='KF972093_W_China.Central_Anseriformes', description='KF972093_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972101_W_China.Central_Anseriformes', name='KF972101_W_China.Central_Anseriformes', description='KF972101_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972109_W_China.Central_Anseriformes', name='KF972109_W_China.Central_Anseriformes', description='KF972109_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITTLIAILLMVTASNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KF972117_W_China.Central_Anseriformes', name='KF972117_W_China.Central_Anseriformes', description='KF972117_W_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLPTE...---', SingleLetterAlphabet()), id='JX294922_D_Middle.East_Galliformes', name='JX294922_D_Middle.East_Galliformes', description='JX294922_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX912984_D_Middle.East_Galliformes', name='JX912984_D_Middle.East_Galliformes', description='JX912984_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVCNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC920697_D_E.Asia.E.China_Galliformes', name='KC920697_D_E.Asia.E.China_Galliformes', description='KC920697_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF715244_D_China.West_Galliformes', name='KF715244_D_China.West_Galliformes', description='KF715244_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX912990_D_Middle.East_Galliformes', name='JX912990_D_Middle.East_Galliformes', description='JX912990_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF258174_D_Middle.East_Galliformes', name='KF258174_D_Middle.East_Galliformes', description='KF258174_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADNICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881394_D_Middle.East_Galliformes', name='KF881394_D_Middle.East_Galliformes', description='KF881394_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF998210_D_Middle.East_Galliformes', name='KF998210_D_Middle.East_Galliformes', description='KF998210_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLTTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF998211_D_Middle.East_Galliformes', name='KF998211_D_Middle.East_Galliformes', description='KF998211_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC920696_D_E.Asia.E.China_Galliformes', name='KC920696_D_E.Asia.E.China_Galliformes', description='KC920696_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881475_D_Middle.East_Galliformes', name='KF881475_D_Middle.East_Galliformes', description='KF881475_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881732_D_Middle.East_Galliformes', name='KF881732_D_Middle.East_Galliformes', description='KF881732_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF998214_D_Middle.East_Galliformes', name='KF998214_D_Middle.East_Galliformes', description='KF998214_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLVVTGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259143_D_China.Central_Galliformes', name='KF259143_D_China.Central_Galliformes', description='KF259143_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLVITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259144_D_China.Central_Galliformes', name='KF259144_D_China.Central_Galliformes', description='KF259144_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLVITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259147_D_China.Central_Galliformes', name='KF259147_D_China.Central_Galliformes', description='KF259147_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLVITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTG...---', SingleLetterAlphabet()), id='KF259148_D_China.Central_Galliformes', name='KF259148_D_China.Central_Galliformes', description='KF259148_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLVITGNNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259156_D_China.Central_Galliformes', name='KF259156_D_China.Central_Galliformes', description='KF259156_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVTIITILLVITRSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259157_D_China.Central_Galliformes', name='KF259157_D_China.Central_Galliformes', description='KF259157_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVCNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC920691_D_E.Asia.E.China_Galliformes', name='KC920691_D_E.Asia.E.China_Galliformes', description='KC920691_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATILITILLTVATSSADKICIGYQSTNSTETVDTLIETNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY157534_W_N.Amer_Anseriformes', name='CY157534_W_N.Amer_Anseriformes', description='CY157534_W_N.Amer_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC879302_D_E.Asia.E.China_Galliformes', name='KC879302_D_E.Asia.E.China_Galliformes', description='KC879302_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLAVAASNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC767259_D_China.West_Galliformes', name='KC767259_D_China.West_Galliformes', description='KC767259_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLLVTVSNADKICIGYQSTNSTETVDTLTENDVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC879299_D_E.Asia.E.China_Galliformes', name='KC879299_D_E.Asia.E.China_Galliformes', description='KC879299_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLLVTVSNADKICIGYQSTNSTETVDTLTENDVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC879300_D_China.Central_Galliformes', name='KC879300_D_China.Central_Galliformes', description='KC879300_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF638575_D_China.West_Galliformes', name='KF638575_D_China.West_Galliformes', description='KF638575_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMIVLLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF258186_D_Middle.East_Galliformes', name='KF258186_D_Middle.East_Galliformes', description='KF258186_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTVLLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF258191_D_Middle.East_Galliformes', name='KF258191_D_Middle.East_Galliformes', description='KF258191_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTVLLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881640_D_Middle.East_Galliformes', name='KF881640_D_Middle.East_Galliformes', description='KF881640_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF638574_D_China.Central_Galliformes', name='KF638574_D_China.Central_Galliformes', description='KF638574_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTVLLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF258183_D_Middle.East_Galliformes', name='KF258183_D_Middle.East_Galliformes', description='KF258183_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTVLLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF258184_D_Middle.East_Galliformes', name='KF258184_D_Middle.East_Galliformes', description='KF258184_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTVLLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF258190_D_Middle.East_Galliformes', name='KF258190_D_Middle.East_Galliformes', description='KF258190_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881378_D_Middle.East_Galliformes', name='KF881378_D_Middle.East_Galliformes', description='KF881378_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MRIIPLTTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881459_D_Middle.East_Galliformes', name='KF881459_D_Middle.East_Galliformes', description='KF881459_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MGIIPLMTVLLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881553_D_Middle.East_Galliformes', name='KF881553_D_Middle.East_Galliformes', description='KF881553_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MGIIPLMTILLLVTTNNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF881370_D_Middle.East_Galliformes', name='KF881370_D_Middle.East_Galliformes', description='KF881370_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLAITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB836739_D_SE.Asia_Galliformes', name='AB836739_D_SE.Asia_Galliformes', description='AB836739_D_SE.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEALSLITTLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KJ419949_D_E.Asia.E.China_Galliformes', name='KJ419949_D_E.Asia.E.China_Galliformes', description='KJ419949_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLAITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB841272_D_SE.Asia_Anseriformes', name='AB841272_D_SE.Asia_Anseriformes', description='AB841272_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259159_D_E.Asia.E.China_Galliformes', name='KF259159_D_E.Asia.E.China_Galliformes', description='KF259159_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259160_D_E.Asia.E.China_Galliformes', name='KF259160_D_E.Asia.E.China_Galliformes', description='KF259160_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259166_D_E.Asia.E.China_Galliformes', name='KF259166_D_E.Asia.E.China_Galliformes', description='KF259166_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHARELLHTE...---', SingleLetterAlphabet()), id='KF259169_D_E.Asia.E.China_Galliformes', name='KF259169_D_E.Asia.E.China_Galliformes', description='KF259169_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHARELLHTE...---', SingleLetterAlphabet()), id='KF259171_D_E.Asia.E.China_Galliformes', name='KF259171_D_E.Asia.E.China_Galliformes', description='KF259171_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITILLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259184_D_E.Asia.E.China_Galliformes', name='KF259184_D_E.Asia.E.China_Galliformes', description='KF259184_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF259186_D_E.Asia.E.China_Galliformes', name='KF259186_D_E.Asia.E.China_Galliformes', description='KF259186_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF297299_D_E.Asia.E.China_Galliformes', name='KF297299_D_E.Asia.E.China_Galliformes', description='KF297299_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX465626_D_Middle.East_Galliformes', name='JX465626_D_Middle.East_Galliformes', description='JX465626_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM773438_D_E.Asia.E.China_Galliformes', name='HM773438_D_E.Asia.E.China_Galliformes', description='HM773438_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTASNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190124_D_China.Central_Galliformes', name='FJ190124_D_China.Central_Galliformes', description='FJ190124_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLRTILLVVTASNADKICIAYQSTNSTETVDTLTETNVPVTHATELLHTE...---', SingleLetterAlphabet()), id='KF313567_D_E.Asia.E.China_Galliformes', name='KF313567_D_E.Asia.E.China_Galliformes', description='KF313567_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATSLITILLLVTTSNADKICIGYQSTNSTETVDTLAENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190129_D_E.Asia.E.China_Galliformes', name='FJ190129_D_E.Asia.E.China_Galliformes', description='FJ190129_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190150_D_China.West_Galliformes', name='FJ190150_D_China.West_Galliformes', description='FJ190150_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190123_D_China.Central_Galliformes', name='FJ190123_D_China.Central_Galliformes', description='FJ190123_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTASNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190128_D_E.Asia.E.China_Galliformes', name='FJ190128_D_E.Asia.E.China_Galliformes', description='FJ190128_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ710462_D_E.Asia.E.China_Galliformes', name='JQ710462_D_E.Asia.E.China_Galliformes', description='JQ710462_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEATSLITILLLVTTSNADKICIGYQSTNSTETVDTLAENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ190117_D_E.Asia.E.China_Galliformes', name='FJ190117_D_E.Asia.E.China_Galliformes', description='FJ190117_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIIILLVVTTSNADKICIGHQSTNSTETVNTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU665422_D_S.Asia_Galliformes', name='EU665422_D_S.Asia_Galliformes', description='EU665422_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLLVTASNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF688983_D_E.Asia.E.China_Galliformes', name='KF688983_D_E.Asia.E.China_Galliformes', description='KF688983_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MDVVSLITIPLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF313559_D_E.Asia.E.China_Galliformes', name='KF313559_D_E.Asia.E.China_Galliformes', description='KF313559_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIIILLVVTTSNADKICIVHQSTNSTETVNTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='EU665423_D_S.Asia_Galliformes', name='EU665423_D_S.Asia_Galliformes', description='EU665423_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVASLITVLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM773435_D_E.Asia.E.China_Galliformes', name='HM773435_D_E.Asia.E.China_Galliformes', description='HM773435_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='HM136574_W_Europe_Anseriformes', name='HM136574_W_Europe_Anseriformes', description='HM136574_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITVLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM773436_D_E.Asia.E.China_Galliformes', name='HM773436_D_E.Asia.E.China_Galliformes', description='HM773436_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVLLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ710463_D_E.Asia.E.China_Galliformes', name='JQ710463_D_E.Asia.E.China_Galliformes', description='JQ710463_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLITILLSVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC986294_D_S.Asia_Galliformes', name='KC986294_D_S.Asia_Galliformes', description='KC986294_D_S.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLIATASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLQTE...---', SingleLetterAlphabet()), id='AB753177_D_SE.Asia_Galliformes', name='AB753177_D_SE.Asia_Galliformes', description='AB753177_D_SE.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ231866_D_E.Asia.E.China_Galliformes', name='FJ231866_D_E.Asia.E.China_Galliformes', description='FJ231866_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434561_D_China.West_Galliformes', name='FJ434561_D_China.West_Galliformes', description='FJ434561_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434562_D_China.West_Galliformes', name='FJ434562_D_China.West_Galliformes', description='FJ434562_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTMSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434572_D_E.Asia.E.China_Galliformes', name='FJ434572_D_E.Asia.E.China_Galliformes', description='FJ434572_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTMSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434585_D_China.Central_Galliformes', name='FJ434585_D_China.Central_Galliformes', description='FJ434585_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434586_D_E.Asia.E.China_Galliformes', name='FJ434586_D_E.Asia.E.China_Galliformes', description='FJ434586_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLVVTTSNADKICIGHQSTNSTETVDTLAETNIPVTHAKELLHTE...VYN', SingleLetterAlphabet()), id='GU071977_D_Middle.East_Galliformes', name='GU071977_D_Middle.East_Galliformes', description='GU071977_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKTISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='GU071980_D_Middle.East_Galliformes', name='GU071980_D_Middle.East_Galliformes', description='GU071980_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434563_D_China.West_Galliformes', name='FJ434563_D_China.West_Galliformes', description='FJ434563_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434564_D_China.West_Galliformes', name='FJ434564_D_China.West_Galliformes', description='FJ434564_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HQ326722_D_E.Asia.E.China_Galliformes', name='HQ326722_D_E.Asia.E.China_Galliformes', description='HQ326722_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ434582_D_E.Asia.E.China_Galliformes', name='FJ434582_D_E.Asia.E.China_Galliformes', description='FJ434582_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF313561_D_China.Central_Galliformes', name='KF313561_D_China.Central_Galliformes', description='KF313561_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='FJ794818_D_Middle.East_Galliformes', name='FJ794818_D_Middle.East_Galliformes', description='FJ794818_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ973661_D_Middle.East_Galliformes', name='JQ973661_D_Middle.East_Galliformes', description='JQ973661_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGASNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HQ221678_D_E.Asia.E.China_Galliformes', name='HQ221678_D_E.Asia.E.China_Galliformes', description='HQ221678_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTK...---', SingleLetterAlphabet()), id='HQ221679_D_E.Asia.E.China_Galliformes', name='HQ221679_D_E.Asia.E.China_Galliformes', description='HQ221679_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='HM773434_D_E.Asia.E.China_Galliformes', name='HM773434_D_E.Asia.E.China_Galliformes', description='HM773434_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MGIISLMTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ254940_D_Middle.East_Galliformes', name='JQ254940_D_Middle.East_Galliformes', description='JQ254940_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MKSIVLIAILLVATTSNADKICIGYQSTNSTETVDTLIESNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='AB545593_D_SE.Asia_Anseriformes', name='AB545593_D_SE.Asia_Anseriformes', description='AB545593_D_SE.Asia_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVIALIAILVVTGTSNADKICIGYQSTNSTETVDTLVETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN852803_D_E.Asia.E.China_Galliformes', name='JN852803_D_E.Asia.E.China_Galliformes', description='JN852803_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MGIISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ254937_D_Middle.East_Galliformes', name='JQ254937_D_Middle.East_Galliformes', description='JQ254937_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ419718_D_Middle.East_Galliformes', name='JQ419718_D_Middle.East_Galliformes', description='JQ419718_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTMSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='CY080415_W_Europe_Anseriformes', name='CY080415_W_Europe_Anseriformes', description='CY080415_W_Europe_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITILLIATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB753192_D_SE.Asia_Galliformes', name='AB753192_D_SE.Asia_Galliformes', description='AB753192_D_SE.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVINADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AB753213_D_SE.Asia_Galliformes', name='AB753213_D_SE.Asia_Galliformes', description='AB753213_D_SE.Asia_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIPLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ419722_D_Middle.East_Galliformes', name='JQ419722_D_Middle.East_Galliformes', description='JQ419722_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METTSLITILLVVTTSNADKICIGHQSTNSTETVDTLTETNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ419723_D_Middle.East_Galliformes', name='JQ419723_D_Middle.East_Galliformes', description='JQ419723_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLIATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN683644_D_E.Asia.E.China_Galliformes', name='JN683644_D_E.Asia.E.China_Galliformes', description='JN683644_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMAILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN646748_D_Middle.East_Galliformes', name='JN646748_D_Middle.East_Galliformes', description='JN646748_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN683647_D_E.Asia.E.China_Galliformes', name='JN683647_D_E.Asia.E.China_Galliformes', description='JN683647_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN803952_D_E.Asia.E.China_Galliformes', name='JN803952_D_E.Asia.E.China_Galliformes', description='JN803952_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN803960_D_E.Asia.E.China_Galliformes', name='JN803960_D_E.Asia.E.China_Galliformes', description='JN803960_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN803964_D_E.Asia.E.China_Galliformes', name='JN803964_D_E.Asia.E.China_Galliformes', description='JN803964_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN803976_D_China.Central_Galliformes', name='JN803976_D_China.Central_Galliformes', description='JN803976_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN803993_D_China.Central_Anseriformes', name='JN803993_D_China.Central_Anseriformes', description='JN803993_D_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN803994_D_China.Central_Anseriformes', name='JN803994_D_China.Central_Anseriformes', description='JN803994_D_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNAHKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN803999_D_China.Central_Anseriformes', name='JN803999_D_China.Central_Anseriformes', description='JN803999_D_China.Central_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715003_D_E.Asia.E.China_Galliformes', name='JF715003_D_E.Asia.E.China_Galliformes', description='JF715003_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY093088_D_Middle.East_Galliformes', name='CY093088_D_Middle.East_Galliformes', description='CY093088_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY093096_D_Middle.East_Galliformes', name='CY093096_D_Middle.East_Galliformes', description='CY093096_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF714997_D_China.Central_Galliformes', name='JF714997_D_China.Central_Galliformes', description='JF714997_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF714998_D_China.Central_Galliformes', name='JF714998_D_China.Central_Galliformes', description='JF714998_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTVLLVVTTSNADKICIGHQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ254942_D_Middle.East_Galliformes', name='JQ254942_D_Middle.East_Galliformes', description='JQ254942_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ254945_D_Middle.East_Galliformes', name='JQ254945_D_Middle.East_Galliformes', description='JQ254945_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ254948_D_Middle.East_Galliformes', name='JQ254948_D_Middle.East_Galliformes', description='JQ254948_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVITTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ254952_D_Middle.East_Galliformes', name='JQ254952_D_Middle.East_Galliformes', description='JQ254952_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTVLLVVTTSNADKICIGHQSTNSTETVDTLTENNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ254954_D_Middle.East_Galliformes', name='JQ254954_D_Middle.East_Galliformes', description='JQ254954_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METIALIAILLLTTACNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='JQ609664_D_Europe_Galliformes', name='JQ609664_D_Europe_Galliformes', description='JQ609664_D_Europe_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITTLLAITTSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715033_D_China.Central_Galliformes', name='JF715033_D_China.Central_Galliformes', description='JF715033_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITTLLAVTTSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715036_D_E.Asia.E.China_Galliformes', name='JF715036_D_E.Asia.E.China_Galliformes', description='JF715036_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITGSNADKIRIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715044_D_China.Central_Galliformes', name='JF715044_D_China.Central_Galliformes', description='JF715044_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLLITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715046_D_China.Central_Galliformes', name='JF715046_D_China.Central_Galliformes', description='JF715046_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715048_D_China.Central_Galliformes', name='JF715048_D_China.Central_Galliformes', description='JF715048_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLLITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715051_D_China.Central_Galliformes', name='JF715051_D_China.Central_Galliformes', description='JF715051_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JF715018_D_E.Asia.E.China_Galliformes', name='JF715018_D_E.Asia.E.China_Galliformes', description='JF715018_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX448760_D_E.Asia.E.China_Galliformes', name='JX448760_D_E.Asia.E.China_Galliformes', description='JX448760_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITTLLVITVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804504_D_E.Asia.E.China_Galliformes', name='JN804504_D_E.Asia.E.China_Galliformes', description='JN804504_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804513_D_China.West_Galliformes', name='JN804513_D_China.West_Galliformes', description='JN804513_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804515_D_China.West_Galliformes', name='JN804515_D_China.West_Galliformes', description='JN804515_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804520_D_China.West_Galliformes', name='JN804520_D_China.West_Galliformes', description='JN804520_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804521_D_China.West_Galliformes', name='JN804521_D_China.West_Galliformes', description='JN804521_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804523_D_China.West_Galliformes', name='JN804523_D_China.West_Galliformes', description='JN804523_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804525_D_China.West_Galliformes', name='JN804525_D_China.West_Galliformes', description='JN804525_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVATLITILLVITGNNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804526_D_China.West_Galliformes', name='JN804526_D_China.West_Galliformes', description='JN804526_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVATLITILLVITGNNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804527_D_China.West_Galliformes', name='JN804527_D_China.West_Galliformes', description='JN804527_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVLLMTTLLAITTSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804534_D_China.Central_Galliformes', name='JN804534_D_China.Central_Galliformes', description='JN804534_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804540_D_China.Central_Galliformes', name='JN804540_D_China.Central_Galliformes', description='JN804540_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLITMLLVATVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804542_D_China.West_Galliformes', name='JN804542_D_China.West_Galliformes', description='JN804542_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVLTVSNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804543_D_China.West_Galliformes', name='JN804543_D_China.West_Galliformes', description='JN804543_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVLTVSNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804544_D_China.West_Galliformes', name='JN804544_D_China.West_Galliformes', description='JN804544_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVLTVSNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804545_D_China.West_Galliformes', name='JN804545_D_China.West_Galliformes', description='JN804545_D_China.West_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVLTVSNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804547_D_China.West_Anseriformes', name='JN804547_D_China.West_Anseriformes', description='JN804547_D_China.West_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAATIITILLAITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JN804557_D_China.Central_Galliformes', name='JN804557_D_China.Central_Galliformes', description='JN804557_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITPLMTILLLVTTSNADKICIGHQSTNSTETVDTLAETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ906555_D_Middle.East_Galliformes', name='JQ906555_D_Middle.East_Galliformes', description='JQ906555_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIALIAILLVTTTSNADKICIGYQSTNSTETVDTLIENNVPVTHTKELLHTE...---', SingleLetterAlphabet()), id='KC162234_W_E.Asia.E.China_Anseriformes', name='KC162234_W_E.Asia.E.China_Anseriformes', description='KC162234_W_E.Asia.E.China_Anseriformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLTTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY110927_D_Middle.East_Galliformes', name='CY110927_D_Middle.East_Galliformes', description='CY110927_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLTTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='CY110928_D_Middle.East_Galliformes', name='CY110928_D_Middle.East_Galliformes', description='CY110928_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVITGSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ770133_D_China.Central_Galliformes', name='JQ770133_D_China.Central_Galliformes', description='JQ770133_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JQ973658_D_Middle.East_Galliformes', name='JQ973658_D_Middle.East_Galliformes', description='JQ973658_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEITSLMTILLVITTSSADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ973660_D_Middle.East_Galliformes', name='JQ973660_D_Middle.East_Galliformes', description='JQ973660_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JQ973652_D_Middle.East_Galliformes', name='JQ973652_D_Middle.East_Galliformes', description='JQ973652_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEPISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='JQ973653_D_Middle.East_Galliformes', name='JQ973653_D_Middle.East_Galliformes', description='JQ973653_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTVLLVVTTSNADKICIGHQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ973654_D_Middle.East_Galliformes', name='JQ973654_D_Middle.East_Galliformes', description='JQ973654_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVATVSYADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC417046_D_E.Asia.E.China_Galliformes', name='KC417046_D_E.Asia.E.China_Galliformes', description='KC417046_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLTTILLLVTTSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ906557_D_Middle.East_Galliformes', name='JQ906557_D_Middle.East_Galliformes', description='JQ906557_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIIPLMTVLLLVTSSNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JQ906558_D_Middle.East_Galliformes', name='JQ906558_D_Middle.East_Galliformes', description='JQ906558_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METASLMTILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KC817014_D_China.Central_Galliformes', name='KC817014_D_China.Central_Galliformes', description='KC817014_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITTLLAVTTSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX448765_D_E.Asia.E.China_Galliformes', name='JX448765_D_E.Asia.E.China_Galliformes', description='JX448765_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEVVSLITILLVVTVCNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='JX846585_D_China.Central_Galliformes', name='JX846585_D_China.Central_Galliformes', description='JX846585_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METVSLITILLVATISNADKICIGYQSTNSTETVDTLTENNVPVTHVKELLHTE...---', SingleLetterAlphabet()), id='KC951122_D_China.Central_Galliformes', name='KC951122_D_China.Central_Galliformes', description='KC951122_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEIISLMTVLLVVTTSNADKICIGHQSTNSTETVDTLTENNIPVTHAKELLHTE...---', SingleLetterAlphabet()), id='KF918709_D_Middle.East_Galliformes', name='KF918709_D_Middle.East_Galliformes', description='KF918709_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('MEAISLMTILLVVTTSNADKICIGHQSTNSTETVDTLTETNVPVTQAKELLHTE...---', SingleLetterAlphabet()), id='KF918708_D_Middle.East_Galliformes', name='KF918708_D_Middle.East_Galliformes', description='KF918708_D_Middle.East_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF156378_D_China.Central_Galliformes', name='AF156378_D_China.Central_Galliformes', description='AF156378_D_China.Central_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLITILLVVTASNADKICIGYQSTNSTETVDTLTETNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF156380_D_E.Asia.E.China_Galliformes', name='AF156380_D_E.Asia.E.China_Galliformes', description='AF156380_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[]),
 SeqRecord(seq=Seq('METISLIAILLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTE...---', SingleLetterAlphabet()), id='AF461532_D_E.Asia.E.China_Galliformes', name='AF461532_D_E.Asia.E.China_Galliformes', description='AF461532_D_E.Asia.E.China_Galliformes <unknown description>', dbxrefs=[])]

In [9]:
df = pd.DataFrame(np.array(genes))

# Capture accession and wild or domestic status as an array.
labels_wd = []
labels_geo = []
labels_wd_geo = []
labels_species = []
labels_wd_species = []
labels_wd_geo_species = []
for sequence in genes:
    if 'nan' in sequence.id:
        pass
    else:
        sequence_id = sequence.id.split("_")
        label_wd = sequence_id[1]
        label_geo = sequence_id[2]
        label_wd_geo = label_wd + '-' + label_geo
        label_species = sequence_id[3]
        label_wd_species = label_wd + "-" + label_species
        label_wd_geo_species = label_wd + "_" + label_geo + "_" + label_species
        
        labels_wd.append(label_wd)
        labels_geo.append(label_geo)
        labels_wd_geo.append(label_wd_geo)
        labels_species.append(label_species)
        labels_wd_species.append(label_wd_species)
        labels_wd_geo_species.append(label_wd_geo_species)
        
# Remove any positions that do not contain any variation
for column in df.columns:
    if len(np.unique(df[column].values)) == 1:
        del df[column]

df


Out[9]:
0 1 2 3 4 5 6 7 8 9 ... 556 557 558 559 560 561 562 563 564 565
0 M E T K A L I A I L ... N I C I - - - - - -
1 M E T T T L I A I L ... N I C I - - - - - -
2 M E T I A P I A I L ... N I C I - - - - - -
3 M E I T T L I A I L ... N I C I - - - - - -
4 M E I T T L V A I L ... N I C I - - - - - -
5 M E I T T L V A I L ... N I C I - - - - - -
6 M E I T T L V A I L ... N I C I - - - - - -
7 M E I T A L I A I L ... N I C I - - - - - -
8 M E T I S L I T I L ... N - - - - - - - - -
9 M E I I A L I A I L ... N I C I - - - - - -
10 M E I I A L I A I L ... N I C I - - - - - -
11 M E T R T L I A A L ... N I C I - - - - - -
12 M E T T S L I T I L ... N I C I - - - - - -
13 M E I I A L I A I L ... N I C I - - - - - -
14 M E A V S L I T I L ... N I C I - - - - - -
15 M E A V S L I T I L ... N I C I - - - - - -
16 M E A T A I I T I L ... N I C I - - - - - -
17 M E Q V S L I T I L ... N I C I - - - - - -
18 M E T I S L I T I L ... N I C I - - - - - -
19 M E T I S L I A I L ... N I C I - - - - - -
20 M E T I S L I T I L ... N I C I - - - - - -
21 M E T V S L I T I L ... N I C I - - - - - -
22 M E T T S L L T I L ... S I E - - - - - - -
23 M E Q V S L I T I L ... N I C - - - - - - -
24 M E T I S L I T I L ... N I C I - - - - - -
25 M E T I S L I T I I ... N I C I - - - - - -
26 M E T R S L I T I L ... - - - - - - - - - -
27 M E T I S L I T I L ... - - - - - - - - - -
28 M E T I S L I T I L ... - - - - - - - - - -
29 M E T R S L I T I L ... - - - - - - - - - -
... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ...
547 M E T V L L M T T L ... N I - - - - - - - -
548 M E T V S L I T I L ... N I - - - - - - - -
549 M E T A S L I T M L ... N I - - - - - - - -
550 M E T V S L I T I L ... N I - - - - - - - -
551 M E T V S L I T I L ... N I - - - - - - - -
552 M E T V S L I T I L ... N I - - - - - - - -
553 M E T V S L I T I L ... N I - - - - - - - -
554 M E A A T I I T I L ... N I - - - - - - - -
555 M E I T P L M T I L ... N I C I - - - - - -
556 M E I I A L I A I L ... N I C I - - - - - -
557 M E I I P L T T I L ... N I C I - - - - - -
558 M E I I P L T T I L ... N I C I - - - - - -
559 M E V V S L I T I L ... N I C I - - - - - -
560 M E I I S L M T I L ... N I C I - - - - - -
561 M E I T S L M T I L ... N I C I - - - - - -
562 M E T I S L M T I L ... N I C I - - - - - -
563 M E P I S L M T I L ... N I C I - - - - - -
564 M E I I S L M T V L ... N I C I - - - - - -
565 M E V V S L I T I L ... N I C I - - - - - -
566 M E I I P L T T I L ... - - - - - - - - - -
567 M E I I P L M T V L ... - - - - - - - - - -
568 M E T A S L M T I L ... N I C I - - - - - -
569 M E V V S L I T T L ... N I C I - - - - - -
570 M E V V S L I T I L ... N I C I - - - - - -
571 M E T V S L I T I L ... N I C I - - - - - -
572 M E I I S L M T V L ... N I C I - - - - - -
573 M E A I S L M T I L ... N I C I - - - - - -
574 M E T I S L I T I L ... - - - - - - - - - -
575 M E T I S L I T I L ... - - - - - - - - - -
576 M E T I S L I A I L ... N I C I - - - - - -

577 rows × 455 columns


In [11]:
print(len(df))
print(len(labels_species))
np.unique(labels_wd_species)
np.unique(labels_wd_geo_species)


577
577
Out[11]:
array(['D_China.Central_Anseriformes', 'D_China.Central_Galliformes',
       'D_China.West_Anseriformes', 'D_China.West_Galliformes',
       'D_E.Asia.E.China_Anseriformes', 'D_E.Asia.E.China_Galliformes',
       'D_Europe_Galliformes', 'D_Middle.East_Anseriformes',
       'D_Middle.East_Galliformes', 'D_S.Asia_Anseriformes',
       'D_S.Asia_Galliformes', 'D_SE.Asia_Anseriformes',
       'D_SE.Asia_Galliformes', 'W_China.Central_Anseriformes',
       'W_E.Asia.E.China_Anseriformes', 'W_Europe_Anseriformes',
       'W_Europe_Charadriiformes', 'W_Middle.East_Anseriformes',
       'W_Middle.East_Charadriiformes', 'W_N.Amer_Anseriformes',
       'W_N.Amer_Charadriiformes'], 
      dtype='|S29')

In [21]:
from random import shuffle
# Encode the amino acids with categorial labels 1-20
le = LabelEncoder()
amino_acid_code = (list('ABCDEFGHIJKLMNPQRSTVWXY-'))
shuffle(amino_acid_code)
print(len(amino_acid_code))
le.fit(amino_acid_code)
a_encoded = le.transform(amino_acid_code)
# a_encoded

# Replace amino acids with integer numbers.
encode_dict = {letter:int(encode) for letter, encode in zip(amino_acid_code, a_encoded)}
# encode_dict
encoded_df = df.replace(to_replace=encode_dict.keys(), value=encode_dict.values())
encoded_df


24
Out[21]:
0 1 2 3 4 5 6 7 8 9 ... 556 557 558 559 560 561 562 563 564 565
0 13 5 19 11 1 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
1 13 5 19 19 19 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
2 13 5 19 9 1 15 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
3 13 5 9 19 19 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
4 13 5 9 19 19 12 20 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
5 13 5 9 19 19 12 20 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
6 13 5 9 19 19 12 20 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
7 13 5 9 19 1 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
8 13 5 19 9 18 12 9 19 9 12 ... 14 0 0 0 0 0 0 0 0 0
9 13 5 9 9 1 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
10 13 5 9 9 1 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
11 13 5 19 17 19 12 9 1 1 12 ... 14 9 3 9 0 0 0 0 0 0
12 13 5 19 19 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
13 13 5 9 9 1 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
14 13 5 1 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
15 13 5 1 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
16 13 5 1 19 1 9 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
17 13 5 16 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
18 13 5 19 9 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
19 13 5 19 9 18 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
20 13 5 19 9 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
21 13 5 19 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
22 13 5 19 19 18 12 12 19 9 12 ... 18 9 5 0 0 0 0 0 0 0
23 13 5 16 20 18 12 9 19 9 12 ... 14 9 3 0 0 0 0 0 0 0
24 13 5 19 9 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
25 13 5 19 9 18 12 9 19 9 9 ... 14 9 3 9 0 0 0 0 0 0
26 13 5 19 17 18 12 9 19 9 12 ... 0 0 0 0 0 0 0 0 0 0
27 13 5 19 9 18 12 9 19 9 12 ... 0 0 0 0 0 0 0 0 0 0
28 13 5 19 9 18 12 9 19 9 12 ... 0 0 0 0 0 0 0 0 0 0
29 13 5 19 17 18 12 9 19 9 12 ... 0 0 0 0 0 0 0 0 0 0
... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ...
547 13 5 19 20 12 12 13 19 19 12 ... 14 9 0 0 0 0 0 0 0 0
548 13 5 19 20 18 12 9 19 9 12 ... 14 9 0 0 0 0 0 0 0 0
549 13 5 19 1 18 12 9 19 13 12 ... 14 9 0 0 0 0 0 0 0 0
550 13 5 19 20 18 12 9 19 9 12 ... 14 9 0 0 0 0 0 0 0 0
551 13 5 19 20 18 12 9 19 9 12 ... 14 9 0 0 0 0 0 0 0 0
552 13 5 19 20 18 12 9 19 9 12 ... 14 9 0 0 0 0 0 0 0 0
553 13 5 19 20 18 12 9 19 9 12 ... 14 9 0 0 0 0 0 0 0 0
554 13 5 1 1 19 9 9 19 9 12 ... 14 9 0 0 0 0 0 0 0 0
555 13 5 9 19 15 12 13 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
556 13 5 9 9 1 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0
557 13 5 9 9 15 12 19 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
558 13 5 9 9 15 12 19 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
559 13 5 20 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
560 13 5 9 9 18 12 13 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
561 13 5 9 19 18 12 13 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
562 13 5 19 9 18 12 13 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
563 13 5 15 9 18 12 13 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
564 13 5 9 9 18 12 13 19 20 12 ... 14 9 3 9 0 0 0 0 0 0
565 13 5 20 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
566 13 5 9 9 15 12 19 19 9 12 ... 0 0 0 0 0 0 0 0 0 0
567 13 5 9 9 15 12 13 19 20 12 ... 0 0 0 0 0 0 0 0 0 0
568 13 5 19 1 18 12 13 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
569 13 5 20 20 18 12 9 19 19 12 ... 14 9 3 9 0 0 0 0 0 0
570 13 5 20 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
571 13 5 19 20 18 12 9 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
572 13 5 9 9 18 12 13 19 20 12 ... 14 9 3 9 0 0 0 0 0 0
573 13 5 1 9 18 12 13 19 9 12 ... 14 9 3 9 0 0 0 0 0 0
574 13 5 19 9 18 12 9 19 9 12 ... 0 0 0 0 0 0 0 0 0 0
575 13 5 19 9 18 12 9 19 9 12 ... 0 0 0 0 0 0 0 0 0 0
576 13 5 19 9 18 12 9 1 9 12 ... 14 9 3 9 0 0 0 0 0 0

577 rows × 455 columns

Analysis by Wild vs. Domestic


In [22]:
# 

# # Run 1000 runs of the Random Forest classifier, and average the feature importances.
# feature_importance_dict = {pos:[] for pos in encoded_df.columns}

# for i in range(1000):
#     rf = RandomForestClassifier()
#     rf.fit_transform(encoded_df, labels_wd)
#     for pos, importance in zip(encoded_df.columns, rf.feature_importances_):
#         feature_importance_dict[pos].append(importance)
        
# # Get the mean for each feature_importance
# mean_importances_wd = {pos:None for key in feature_importance_dict.keys()}

# for pos, importances in feature_importance_dict.items():
#     mean_importances_wd[pos] = np.mean(importances)

In [23]:
def run_rfa(data, labels, n_runs, scatter_color, analysis_name, gene_name):
    """
    This function runs the Random Forest Algorithm on an alignment.
    
    Inputs:
    - data: a pandas DataFrame with the amino acids aligned and encoded as integers.
    - labels: a list of labels
    - n_runs: the number of times the Random Forests are to be run.
    - scatter_color: the color of the scatterplot dots.
    - analysis_name: a string handle labelling the analysis.
    - gene_name: the name of the influenza gene.
    
    Outputs:
    - SAVE TO DISK: 
        - A scatter plot of Relative Feature Importance vs. Position in Alignment.
        - A CSV file of the relative feature importances.
    - RETURN: mean_importances: a dictionary of positions and the mean feature_importances.
    """
    feature_importances_dict = {pos:[] for pos in encoded_df.columns}
    permuted_importances = []
    
    labels_copy = deepcopy(labels)
    
    for i in range(n_runs):
        if i % 20 == 0:
            print("Currently at iteration {0}.".format(i))
        
        # Fit-transform based on ground truth labels.
        rf = RandomForestClassifier()
        rf.fit_transform(data, labels)
        for pos, importance in zip(data.columns, rf.feature_importances_):
            feature_importances_dict[pos].append(importance)
            
        # Fit-predict on shuffled labels.
        shuffle(labels_copy)
        rf_shuffled = RandomForestClassifier()
        rf_shuffled.fit_transform(data, labels_copy)
        
        for importance in rf_shuffled.feature_importances_:
            permuted_importances.append(importance)
            
    # This is where the permutation test is performed. 
    mean_importances = {pos:None for key in feature_importances_dict.keys()}
    threshold = mquantiles(permuted_importances, 0.95)[0]
    print("Threshold Importance: {0}".format(threshold))
    
    for pos, importances in feature_importances_dict.items():
        if np.mean(importances) > threshold:
            mean_importances[pos] = np.mean(importances)
        
    # Generate scatterplot
    plt.scatter(mean_importances.keys(), mean_importances.values(), color=scatter_color)
    plt.title('{0} \n Positional Importances for {1} Gene'.format(analysis_name, gene_name))
    plt.xlabel('Position in Amino Acid Alignment')
    plt.ylabel('Relative Feature Importance')
    plt.savefig('{0} {1} Positional Feature Importances.pdf'.format(analysis_name, gene_name))
    
    # Generate CSV file of ranked importances
    pos_importance = sorted(mean_importances.items(), key=lambda x:x[1])[::-1]
    pos_by_importance = [pos for (pos, score) in pos_importance]
    importances_df = pd.DataFrame(pos_importance)
    importances_df.columns=['Position', 'Relative Importance']
    importances_df.to_csv('{0} {1} Relative Importances.csv'.format(analysis_name, gene_name))

    return pos_importance, importances_df

In [24]:
def group_proportions_piecharts(counter, pos, groups, analysis_type, figsize):
    
    groups_letters = dict()
    for group in list(set(groups)):
        groups_letters[group] = [letter for (letter, state) in counter[pos].keys() if state == group]
    letters = set([letter for (letter, state) in counter[pos].keys()])

    group_proportions = dict()
    for group in list(set(groups)):
        group_proportions[group] = dict()
        
    for letter in letters:
        for group in group_proportions.keys():
            if letter in groups_letters[group]:
                group_proportions[group][letter] = counter[pos][(letter, group)]
            if letter not in groups_letters[group]:
                group_proportions[group][letter] = 0

    numgroups = len(set(groups))
    fig = plt.figure(figsize=figsize)
    sorted_groups = sorted(groups, key=lambda x: (x.split('-')[1], x.split('-')[0]) if '-' in x else x)
    for group in sorted_groups:
        
        if len(letters) < 3:
            bmap = brewer2mpl.get_map('Set3', 'qualitative', 3)
        elif len(letters) > 12:
            bmap = brewer2mpl.get_map('Set3', 'qualitative', 12)
        else:
            bmap = brewer2mpl.get_map('Set3', 'qualitative', len(letters))
        colors = bmap.mpl_colors

        num_cols = 2
        num_rows = numgroups // num_cols + 1
        position = sorted_groups.index(group) + 1
        
        diversity = sdi(group_proportions[group])
        ax = fig.add_subplot(num_rows, num_cols, position)
        plt.pie(group_proportions[group].values(), colors=colors, radius=10)
        plt.axis('equal')
        plt.title('{0}, Pos {1}, \n n={2}, sdi={3}'.format(group, pos, sum(group_proportions[group].values()), round(diversity, 3)))
    
    plt.legend(labels=letters, loc="center left", bbox_to_anchor=(1.0, 0.5), ncol=2)
    plt.savefig('{0} {1} Position {2} Proportion of Amino Acids.pdf'.format(analysis_type, gene, pos), bbox_inches='tight')
    plt.show()

In [25]:
def normalize_counts(counter):
    # Custom function to normalize counts to a proportion from 0 to 1.0.
    total = sum(counter.values())
    
    if total != 0:
        normalized_counter = {key:float(value/total) for key, value in counter.items()}
    
    else:
        normalized_counter = {key:1 for key, value in counter.items()}
    return normalized_counter

In [26]:
def cumulative_importances(importances_df, analysis_name):
    importances_df.cumsum()['Relative Importance'].plot()
    plt.xlabel('Rank Order')
    plt.ylabel('Cumulative Importance')
    plt.title('{0} Cumulative Importances of\nRanked Amino Acid Positions'.format(analysis_name))
    plt.savefig('{0} Cumulative Importances.pdf'.format(analysis_name))

Analysis by Ecotype


In [27]:
pos_importance_ecotype, importances_ecotype = run_rfa(data=encoded_df, 
                                                         labels=labels_wd, 
                                                         n_runs=1000, 
                                                         scatter_color='r', 
                                                         analysis_name='Ecotype', 
                                                         gene_name='HA')


Currently at iteration 0.
Currently at iteration 20.
Currently at iteration 40.
Currently at iteration 60.
Currently at iteration 80.
Currently at iteration 100.
Currently at iteration 120.
Currently at iteration 140.
Currently at iteration 160.
Currently at iteration 180.
Currently at iteration 200.
Currently at iteration 220.
Currently at iteration 240.
Currently at iteration 260.
Currently at iteration 280.
Currently at iteration 300.
Currently at iteration 320.
Currently at iteration 340.
Currently at iteration 360.
Currently at iteration 380.
Currently at iteration 400.
Currently at iteration 420.
Currently at iteration 440.
Currently at iteration 460.
Currently at iteration 480.
Currently at iteration 500.
Currently at iteration 520.
Currently at iteration 540.
Currently at iteration 560.
Currently at iteration 580.
Currently at iteration 600.
Currently at iteration 620.
Currently at iteration 640.
Currently at iteration 660.
Currently at iteration 680.
Currently at iteration 700.
Currently at iteration 720.
Currently at iteration 740.
Currently at iteration 760.
Currently at iteration 780.
Currently at iteration 800.
Currently at iteration 820.
Currently at iteration 840.
Currently at iteration 860.
Currently at iteration 880.
Currently at iteration 900.
Currently at iteration 920.
Currently at iteration 940.
Currently at iteration 960.
Currently at iteration 980.
Threshold Importance: 0.00895522707609

In [28]:
cumulative_importances(importances_ecotype, 'Ecotype')



In [29]:
counts_wd = dict()
for pos in df.columns:
    counts_wd[pos] = Counter(zip(df[pos].values, labels_wd))

for pos, importance in pos_importance_ecotype[0:10]:
    group_proportions_piecharts(counts_wd, pos, list(set(labels_wd)), 'Ecotype', figsize=(6, 6))


Analysis by Geography


In [30]:
pos_importance_geo, importances_geo = run_rfa(data=encoded_df, labels=labels_geo, n_runs=1000, scatter_color='r', analysis_name='Geography', gene_name='HA')


Currently at iteration 0.
Currently at iteration 20.
Currently at iteration 40.
Currently at iteration 60.
Currently at iteration 80.
Currently at iteration 100.
Currently at iteration 120.
Currently at iteration 140.
Currently at iteration 160.
Currently at iteration 180.
Currently at iteration 200.
Currently at iteration 220.
Currently at iteration 240.
Currently at iteration 260.
Currently at iteration 280.
Currently at iteration 300.
Currently at iteration 320.
Currently at iteration 340.
Currently at iteration 360.
Currently at iteration 380.
Currently at iteration 400.
Currently at iteration 420.
Currently at iteration 440.
Currently at iteration 460.
Currently at iteration 480.
Currently at iteration 500.
Currently at iteration 520.
Currently at iteration 540.
Currently at iteration 560.
Currently at iteration 580.
Currently at iteration 600.
Currently at iteration 620.
Currently at iteration 640.
Currently at iteration 660.
Currently at iteration 680.
Currently at iteration 700.
Currently at iteration 720.
Currently at iteration 740.
Currently at iteration 760.
Currently at iteration 780.
Currently at iteration 800.
Currently at iteration 820.
Currently at iteration 840.
Currently at iteration 860.
Currently at iteration 880.
Currently at iteration 900.
Currently at iteration 920.
Currently at iteration 940.
Currently at iteration 960.
Currently at iteration 980.
Threshold Importance: 0.00791429997177

In [31]:
cumulative_importances(importances_geo, 'Geography')



In [32]:
counts_geo = dict()
for pos in df.columns:
    counts_geo[pos] = Counter(zip(df[pos].values, labels_geo))

for pos, importance in pos_importance_geo[0:10]:
    group_proportions_piecharts(counts_geo, pos, list(set(labels_geo)), 'Geography', figsize=(6, 17))